CAZyme Information: FOXG_06509-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_06509-t26_1-p1
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
700		76097.07	8.3452

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000591.1:2371779-2375222(+)

Full Sequence      

MAEATAPNPTSTETMAQTEPKSLSHHMHGPGHHDGHKHHDGHKHHESNGLGNITIKDADS
QNITSGNVQADGRVKVQFHQHAQSVVSWFKGCQSRAVPTEPFKKRSCNTVSLNSQQLVTT
PRLNIAIHIIGSRGDVQPFIPVAQALSRPPYSHRVRICTHPVFKHFIESQGIEFFSIGGD
PEALMAYMVKNPGLLPSRKSVKAGEIKKRREEMWEILIGAWRSCIEAGDGMGDRVMAANV
RETKDLFIADAIIANPPSMAHIHCAEKLGIPLHMSWSCLHGKANHYMPTPDLVGFLEKGP
PPIYIGFGSIVIEDPPALTQLIFDAVKLAGVRAIISRGWGGIGRGDIPETICLIGDCPHD
WLFQRVSAVVHHGGAGTTAAGIAAGRPTVIVPFFGDQPFWGQMIAQAGAGPTPIPFKELT
AEILASSIIFSLKTEVQEAVQKMAERIGAEDGACGTAVDFQERLDIDHLRCDICPDRLAV
WRHKTTGTHLSGFAAACLVDKGLLDPRDFKLLKHKHWEAHQGPPPNTNGNGMTIAELTNP
THNGILKDSIRLAPTELENFAHKMATKSLLTGEIPTPETKRVPTLHERRKATWKAQEQGP
RGHMFYIMHITGRFAADVAKAGLKVPVALVYNVANGFHNYPSYTSNAVEVRQRNEITGLG
SGACTAGREFVLGLWDAFSGVVIKPYQGAKAEAGKGFGKG

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	282	457	3.4e-45	0.4031413612565445

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	5.80e-40	123	464	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	9.34e-29	125	453	4	388	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	1.01e-14	125	288	1	131	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
273616	MGT	0.001	297	464	222	389	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD46415.1|GT1	2.00e-272	118	700	58	795
QKD57931.1|GT1	3.75e-271	46	700	7	805
UPK91708.1|GT1	5.51e-271	47	700	8	810
AAD00894.3|GT1	2.65e-265	46	700	5	835
QKD55584.1|GT1	9.21e-263	46	700	7	816

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	9.11e-39	130	452	27	427	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	1.24e-38	130	452	47	447	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
3H4I_A	1.42e-27	289	479	210	394	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1IIR_A	5.44e-27	289	453	227	388	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
1RRV_A	1.04e-19	290	457	227	392	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	3.17e-87	100	464	132	574	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	2.58e-78	103	464	173	610	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q54IL5|UGT52_DICDI	7.33e-49	111	463	1152	1607	UDP-sugar-dependent glycosyltransferase 52 OS=Dictyostelium discoideum OX=44689 GN=ugt52 PE=2 SV=1
sp|A0A2Z4HPY4|EFUA_HORCR	6.44e-48	104	518	678	1182	Enfumafungin synthase efuA OS=Hormonema carpetanum OX=284138 GN=efuA PE=3 SV=1
sp|Q9Y751|ATG26_KOMPG	2.66e-46	113	452	751	1166	Sterol 3-beta-glucosyltransferase OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=ATG26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999998	0.000039

TMHMM  Annotations     

There is no transmembrane helices in FOXG_06509-t26_1-p1.