CAZyme Information: FOXG_05772-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_05772-t26_1-p1
• CAZy Family: CE12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
600		66515.22	4.7109

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000590.1:583379-585283(+)

Full Sequence      

MWSSLLLLGGVSLSIANPIVRQDANPPYRNKTLCLDKRVDDLMSRMSLEDKAGQMFHGRT
VVVNNTFDETIEEFVTGKRITHYVLSGGVNDVRGVANWYNKLQRLSQSTPLGIPITISSD
PQHGWTDENAVSVVAQGFSRWTEPLGLAALRSPELVRQFAEIAREEYVAVGIRQALHPQV
DLATEPRWGRITGTMGEDANLTSALMVEYIKGLKGDKIGPNSVIATTKHFPGGGPMEDGE
DSHFPWGKNQTYPGNNQDYHLIPFKAAIAAGTRQMMPYYSRPINTSWEEVAFGFNKGVVN
DLLKKELGFDGIVVTDWGIVTTRFWGLEDQTELERARRVLEAGCDIFGGETKPELIIELV
NKGLISEARIDESVRKLMKEKFELGLFDNPFVDVDKAERIAGNDYFSRLGNETQRRAFTL
LTNKDDVLPLPLSALNAKFYIEGIEPEVMESRNLSVVENPEDADYAFLRLASPFKPTTAP
GLPAMINNGSLEFNTTEKARQAKIYATLPTVVDIRLNRPAAVPEVAEQAVALFGSYGSSH
DAFLDVVFGTDGWGPEGRLPFDLPVSQEAADAQMEDIPFDVEALFKFGHGLRYKDTCDSS

Enzyme Prediction     

EC	3.2.1.21:5	3.2.1.38:1	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	107	346	7.4e-58	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	8.27e-60	46	445	1	364	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	5.67e-50	47	377	1	313	Glycosyl hydrolase family 3 N terminal domain.
185053	PRK15098	7.87e-36	36	434	35	411	beta-glucosidase BglX.
178629	PLN03080	3.29e-13	178	435	156	420	Probable beta-xylosidase; Provisional
235417	PRK05337	1.32e-05	196	346	138	276	beta-hexosaminidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD53531.1|GH3	0.0	1	600	1	600
QGI92047.1|GH3	0.0	1	600	1	622
QGI61148.1|GH3	0.0	1	600	1	622
CCT64822.1|GH3	0.0	1	600	1	622
QGI78326.1|GH3	0.0	1	600	1	602

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M6G_A	1.72e-55	3	593	14	614	Crystal structure Glucan 1,4-beta-glucosidase from Saccharopolyspora erythraea [Saccharopolyspora erythraea D]
1LQ2_A	8.30e-40	28	596	5	602	Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with gluco-phenylimidazole [Hordeum vulgare],1X38_A crystal structure of barley beta-D-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole [Hordeum vulgare],1X39_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole [Hordeum vulgare]
1EX1_A	8.57e-40	28	596	5	602	Beta-d-glucan Exohydrolase From Barley [Hordeum vulgare],1IEQ_A Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase Isoenzyme Exo1 [Hordeum vulgare],1IEV_A Crystal Structure Of Barley Beta-d-glucan Glucohydrolase Isoenzyme Exo1 In Complex With Cyclohexitol [Hordeum vulgare],1IEW_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with 2-deoxy-2-fluoro-alpha-D-glucoside [Hordeum vulgare],1IEX_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with 4I,4III,4V-S-trithiocellohexaose [Hordeum vulgare],1J8V_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with 4'-nitrophenyl 3I-thiolaminaritrioside [Hordeum vulgare],3WLH_A Crystal Structure Analysis of Plant Exohydrolase [Hordeum vulgare subsp. vulgare],3WLJ_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with 3-deoxy-glucose [Hordeum vulgare subsp. vulgare],3WLK_X Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with 4-deoxy-glucose [Hordeum vulgare subsp. vulgare],3WLL_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with PEG400 [Hordeum vulgare subsp. vulgare],3WLM_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme exo1 in complex with octyl-O-glucoside [Hordeum vulgare subsp. vulgare],3WLN_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with octyl-S-glucoside [Hordeum vulgare subsp. vulgare],3WLP_A Crystal Structure Analysis of Plant Exohydrolase [Hordeum vulgare subsp. vulgare]
6JGG_A	8.94e-40	28	596	9	606	Crystal structure of barley exohydrolaseI W434F mutant in complex with methyl 2-thio-beta-sophoroside. [Hordeum vulgare subsp. vulgare],6JGK_A Crystal structure of barley exohydrolaseI W434F mutant in complex with 4I,4III,4V-S-trithiocellohexaose [Hordeum vulgare subsp. vulgare],6LBV_A Crystal structure of barley exohydrolaseI W434F mutant in complex with methyl 6-thio-beta-gentiobioside [Hordeum vulgare subsp. vulgare],6LC5_A Crystal structure of barley exohydrolaseI W434F in complex with 4'-nitrophenyl thiolaminaribioside [Hordeum vulgare subsp. vulgare]
3WLI_A	8.94e-40	28	596	9	606	Crystal Structure Analysis of Plant Exohydrolase [Hordeum vulgare subsp. vulgare],3WLO_A Crystal Structure Analysis of Plant Exohydrolase [Hordeum vulgare subsp. vulgare],6JG1_A Chain A, Barley exohydrolase I [Hordeum vulgare subsp. vulgare],6JG2_A Chain A, Barley exohydrolase I [Hordeum vulgare subsp. vulgare],6MD6_A CRYSTAL STRUCTURE ANALYSIS OF PLANT EXOHYDROLASE IN COMPLEX WITH METHYL 2-THIO-BETA-SOPHOROSIDE [Hordeum vulgare subsp. vulgare]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8NGU6|BGLC_ASPFN	9.39e-246	21	600	35	629	Probable beta-glucosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglC PE=3 SV=1
sp|Q2UFP8|BGLC_ASPOR	1.53e-245	21	600	39	633	Probable beta-glucosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglC PE=3 SV=2
sp|Q5BCC6|BGLC_EMENI	9.54e-237	10	596	19	618	Beta-glucosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglC PE=1 SV=1
sp|Q46684|BGLX_DICCH	1.21e-115	10	591	35	652	Periplasmic beta-glucosidase/beta-xylosidase OS=Dickeya chrysanthemi OX=556 GN=bgxA PE=3 SV=1
sp|T2KMH9|PLH34_FORAG	1.24e-39	28	595	29	640	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000249	0.999721	CS pos: 16-17. Pr: 0.9640

TMHMM  Annotations     

There is no transmembrane helices in FOXG_05772-t26_1-p1.