CAZyme Information: FOXG_05730-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_05730-t26_1-p1
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
288	CM000590.1|CGC20	31012.35	8.0306

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000590.1:482854-483720(+)

Full Sequence      

MHLVTLLAASLVLRLPYALAMPSRRAVKCGYETYPLPGQTCSTFAKDWSMTVDELKSLNP
GLKCPKLNPVGYYCVDGTVDKVKPTGVVSNTTEPTSAPVPPPDKTPDAPSDAKSTAKPTV
PQKPSPADEYSGSGIQTPRPIQEGMVANCNKFHYVTTTTTCQSVLDYHKISLADFFKWNP
AVGKDCTNLWKGTNACVCVNGYTSSPTTNTKPNPVGITSDNGFTTPSPIQAGLVKNCVKF
HYIGAGTTCHSVLHHYKITMAQFAQWNPAVGEDCTNLWNDTYACVAAI

Enzyme Prediction     

EC	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
212030	LysM	0.001	37	69	7	39	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
197609	LysM	0.003	37	69	6	38	Lysin motif.
396179	LysM	0.004	37	69	5	36	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD53575.1|CBM50	1.25e-200	1	288	1	288
QGI61174.1|CBM50	9.05e-141	1	288	1	298
QGI92072.1|CBM50	9.05e-141	1	288	1	298
QGI78351.1|CBM50	9.05e-141	1	288	1	298
CCT64847.1|CBM50	2.12e-139	1	288	1	298

PDB Hits     

FOXG_05730-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ALG0|LYSM1_ARTBC	1.79e-43	123	288	297	458	LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05157 PE=1 SV=1
sp|D4B4P8|LYSM2_ARTBC	6.98e-17	157	284	37	178	LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03438 PE=3 SV=1
sp|D4AZ68|LYSM3_ARTBC	2.04e-16	119	285	235	406	LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01488 PE=3 SV=1
sp|D4B5F9|PGDA_ARTBC	2.26e-09	142	199	380	437	Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03699 PE=1 SV=2
sp|D4B4Q2|LYSM4_ARTBC	6.38e-06	230	288	303	361	LysM domain-containing protein ARB_03442 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03442 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000191	0.999778	CS pos: 20-21. Pr: 0.9714

TMHMM  Annotations     

There is no transmembrane helices in FOXG_05730-t26_1-p1.