CAZyme Information: FOXG_05708-t26_4-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_05708-t26_4-p1
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
861		95772.36	5.8043

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000590.1:422764-425635(-)

Full Sequence      

MNDSNSPSTPDTEYSPPCSPQQKIQHLRDTRSAAREKLARLTLVEKVSLLTAADFWRTKA
IPEKGIPSIKTTDGPNGARGGIFVGGTKAALFPCGISLAATWNKDLLYQVGQHLALEVRA
RSAEMLLAPTVCMHRHPLGGRNFESFSEDPLLTGKLAAQYIKGLQDRGVAATIKHFVGNE
QETNRLTIDSLITERPLREIYLKPFEIAVREANPWAVMTSYNLINGVHADLNKHTLKDIL
RGEWGYEGTVVSDWGGINSSIESVEAGCDIEFPYSSKWRLDKLVTAVNEGRISIEDINQA
AENVLTLVERLKGGNMSPEAPEREDDREETRELIRIAGHEGLTLLKNDGGILPLCPKSTK
VAVIGPNANRHIAGGGGSASLNPYYNTIPLDSIRKVSKQKVSFAQGCHIHKWLPVASEYC
TEQSGKPGVHIDWYAGDKFEGNPVVKQRRTNTDLFLWDSAPLSEVGPEWSAVATTYLMPR
TTGKHTISFMSVGPGKLFINDKLVLDLWDWTEEGEAMFDGSIDYLVDVDMEADKAVELRV
EMTNELRPISKQKQFGITHKYGGCRIGYKEQDQVDYIQQAVQTARDADVAVVIVGVDAEW
ESEGYDRQTMDLPADGNQDRFIEAVVKANPKTVVINQSGSPVHMPWVDRVPVILQGWYQG
QEAGNALADVLFGIENPSGKLPSTFPKRIEHTPAWHTWPGENHKVLYGEGLYIGYRHYDH
AKIEPLFPFGHGLSYTTFEYGRPEISTKTLTPDGQIKITLAISNIGARAGAEIVQLYVHD
EKSRLPRPEKELVAFEKVFLEAEETRHITIKLDKYAVGYYDETVPGWIAEEGAFKVLIGA
SSTDIRQSTRFNVKESFTWVF

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	60	272	1.2e-70	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.14e-91	92	852	120	763	beta-glucosidase BglX.
224389	BglX	4.17e-78	54	379	48	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	1.22e-58	342	715	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	3.88e-51	65	307	65	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	1.78e-48	34	813	53	743	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI61209.1|GH3	0.0	1	861	1	858
QGI78386.1|GH3	0.0	1	861	1	858
QGI92108.1|GH3	0.0	1	861	1	858
CCT64887.1|GH3	0.0	1	861	1	858
QKD53598.1|GH3	0.0	1	846	1	843

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	2.38e-186	38	859	10	842	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	7.20e-182	38	859	10	842	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	8.63e-153	38	858	9	679	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.28e-120	41	845	12	655	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	7.79e-114	36	855	6	715	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	7.34e-218	38	845	15	830	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|A1DNN8|BGLJ_NEOFI	8.56e-207	38	836	18	838	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1
sp|P27034|BGLS_RHIRD	8.06e-201	38	853	6	810	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|Q4WLY1|BGLJ_ASPFU	2.46e-200	38	836	18	839	Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglJ PE=3 SV=2
sp|B0Y8M8|BGLJ_ASPFC	6.91e-200	38	836	18	839	Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglJ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000077	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOXG_05708-t26_4-p1.