CAZyme Information: FOXG_05670-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_05670-t26_1-p1
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
801		85179.30	8.2782

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000590.1:320034-322439(+)

Full Sequence      

MRFTLSSMAGLLGLASAQGLRSSAYTDPKTGIDFQRFVDDGYSLGIAVPETLGKDLIAQM
VFPREKEGWGGISFRGGMVGGLLFVAWPNGDDIVTSFRMANSYANPDVYTNTTVKATPIP
DGTFINSTHVSYTFLCEGCVVEKTTSLTGESPVVGYAWSSIDVDTPSDPESALSYHGAGF
GQFGLDIKKAASAKFATWADMAKETTPAPGTGTPGVPGNSTTLPPTTSNVTYDVIVVGGG
PAGIIAAERLAESGASVLLIERGPANTVALGNAAQALPWNNTLTPYDIPALGSSMTSMSG
TKFCSDTASTAGCLLGGSSSINGLNFIHPPERDFQRWPKGWSWSDLSKAADRLYERNPGS
TSPSDDGKYYDDRTYTILSGYLSAKGWKEVDSIEEPNEKHLVYSRPSWSIKNNMRAGPAR
TYMPFAKNLPNFTLKLETKVIQPIRSGSKITGVLTQGANGSKQIINVKAGGKVVLAAGAM
STPRLLWNAGIGKSDALAIVKQGASKTGVTLPAASDFIDLPVGHHLQDHAQVMLQFKTKS
NFTAYKFNNIATEPVKSDLELYYQGSGPITQAAQRMHLWTSAKGADGRVRYLQGTASAMA
DGIITVRTFLTHGTSTVGELGITAGGNTVLNTKPWLIDQEDRKAMADFVQYWLDLTSGSN
STLSYITPGATVDDILATKMISGDHWMGSAKMGVDDGRKANGSAVVDLNTKVYGTDNLFV
VDASMHPDLPTGNTQAIIMVAAEHAAEKIAALKVGGSNSTVPEPISSAPTPVPTPGSKCK
RGLHRRRAARVPMDFRRRSLY

Enzyme Prediction     

EC	1.1.99.18:13	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	224	752	7.2e-207	0.9817518248175182
AA8	25	198	2e-53	0.9945054945054945

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406418	CDH-cyt	4.69e-60	25	194	1	177	Cytochrome domain of cellobiose dehydrogenase. CDH-cyt is the cytochrome domain, at the N-terminus, of cellobiose dehydrogenase. CDH-cyt folds as a beta sandwich with the topology of the antibody Fab V(H) domain and binds iron. The haem iron is ligated by Met83 and His181 in UniProtKB:Q01738.
225186	BetA	2.54e-44	225	751	1	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
187688	CDH_like_cytochrome	4.99e-43	24	186	1	167	Heme-binding cytochrome domain of fungal cellobiose dehydrogenases. Cellobiose dehydrogenase (CellobioseDH or CDH) is an extracellular fungal oxidoreductase that degrades both lignin and cellulose. Specifically, CDHs oxidize cellobiose, cellodextrins, and lactose to corresponding lactones, utilizing a variety of electron acceptors. Class-II CDHs are monomeric hemoflavoenzymes that are comprised of a b-type cytochrome domain linked to a large flavodehydrogenase domain. The cytochrome domain of CDH and related enzymes, which this model describes, folds as a beta sandwich and complexes a heme molecule. It is found at the N-terminus of this family of enzymes, and belongs to the DOMON domain superfamily, a ligand-interacting motif found in all three kingdoms of life.
274888	Rv0697	5.23e-30	233	747	2	484	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
235000	PRK02106	3.20e-29	231	769	5	543	choline dehydrogenase; Validated

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD53637.1|AA3_1|AA8	0.0	1	801	1	801
QGI92142.1|AA3_1|AA8	0.0	1	792	1	792
QGI78425.1|AA3_1|AA8	0.0	1	785	1	785
QGI61244.1|AA3_1|AA8	0.0	1	785	1	766
QPC78224.1|AA3_1|AA8	0.0	1	801	1	810

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QI7_A	9.74e-127	25	763	7	774	Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A],4QI7_B Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A]
4QI6_A	8.84e-118	23	752	6	767	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
1KDG_A	3.20e-91	225	755	1	545	Chain A, cellobiose dehydrogenase [Phanerodontia chrysosporium],1KDG_B Chain B, cellobiose dehydrogenase [Phanerodontia chrysosporium]
4QI4_A	3.30e-91	225	752	1	545	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides],4QI5_A Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
1NAA_A	5.68e-90	232	755	3	540	Chain A, Cellobiose dehydrogenase [Phanerodontia chrysosporium],1NAA_B Chain B, Cellobiose dehydrogenase [Phanerodontia chrysosporium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01738|CDH_PHACH	2.44e-124	4	755	5	772	Cellobiose dehydrogenase OS=Phanerodontia chrysosporium OX=2822231 GN=CDH-1 PE=1 SV=1
sp|Q988C9|4PADH_RHILO	1.84e-25	232	755	7	539	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|A6X2G7|BETA_BRUA4	1.34e-21	233	749	4	525	Oxygen-dependent choline dehydrogenase OS=Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37) OX=439375 GN=betA PE=3 SV=1
sp|Q0R4L2|PDH3_LEUMG	5.23e-21	228	750	37	596	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|P46371|YTH2_RHOER	1.65e-20	233	746	8	486	Uncharacterized GMC-type oxidoreductase in thcA 5'region OS=Rhodococcus erythropolis OX=1833 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.003282	0.996703	CS pos: 17-18. Pr: 0.9494

TMHMM  Annotations     

There is no transmembrane helices in FOXG_05670-t26_1-p1.