CAZyme Information: FOXG_04765-t26_2-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_04765-t26_2-p1
• CAZy Family: CBM48
• CAZyme Description: murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
551		58427.36	6.8062

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000595.1:233211-235108(+)

Full Sequence      

MRHSFISALIAVGSAVQAAAQLNGKVGPLTTPSAKAAIKTCNIVDYGAKANAKTDNGPAI
QKAWNDCRTSGGEVYVPEGDYGLGTWVTLTSSKPMSFRLDGIIYRIGTDGGNMFMFKHLE
DFEFYSSTSKGAIQGYGYEFHKKDEYGPRILRFADVKSFSIHDVALVDSPAFHFSIDTCS
DGEVYNMAIHGGNRGGLDGIDVWGTNIHITTLKSATRTMRLCPESPLTTSWSRTSSATWP
GGLGQWGPLGTGHWERIHDIEYNNIYTQRSNQMYMFKSYGGSGTVNNVALKNFAGHSNAY
TLDLDAQWSSMKPIAGDGILYTNMTFSGWSGTCADGHQRGPIKFNCPADVPCTDMQVDDF
TVRSNKGDTVEHVCKNAYGSGACLKKGDGGAYTTTQTVDAASAATPTMDGEIENGLGLTV
SIAIPTIRPSFFPGVAAISPRMADASKAQATARVETSVPTEAETAADTSAVADVTAPINT
SAASSTSAAVSEVTPVATSTASTDAPNSLLPEEHSTLETAVKASKTAKTAAVTSNVLPKI
PSCKAKRRRSI

Enzyme Prediction     

EC	3.2.1.171:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	66	378	5e-30	0.9661538461538461

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215426	PLN02793	5.77e-12	5	380	20	412	Probable polygalacturonase
215540	PLN03010	2.11e-10	42	379	48	391	polygalacturonase
165802	PLN02155	1.47e-07	42	379	29	380	polygalacturonase
395231	Glyco_hydro_28	1.37e-06	148	383	85	321	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
403800	Pectate_lyase_3	2.22e-05	42	81	3	44	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD53836.1|GH28	0.0	1	551	1	548
QGI94855.1|GH28	8.03e-315	1	551	1	547
QGI63973.1|GH28	8.03e-315	1	551	1	547
CCT68019.1|GH28	8.03e-315	1	551	1	547
QGI81242.1|GH28	8.03e-315	1	551	1	547

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RMG_A	1.97e-144	21	435	1	414	Rhamnogalacturonase A From Aspergillus Aculeatus [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5ARE6|RHGA_EMENI	3.21e-156	5	469	2	474	Rhamnogalacturonase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=rhgA PE=2 SV=2
sp|A2QYE5|RHGA_ASPNC	1.54e-146	21	448	19	446	Probable rhamnogalacturonase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rhgA PE=3 SV=1
sp|B8NK45|RHGA_ASPFN	2.50e-145	3	434	2	433	Probable rhamnogalacturonase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rhgA PE=3 SV=1
sp|Q2U293|RHGA_ASPOR	7.10e-145	3	434	2	433	Probable rhamnogalacturonase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rhgA PE=3 SV=1
sp|Q00001|RHGA_ASPAC	2.31e-144	1	435	1	432	Rhamnogalacturonase A OS=Aspergillus aculeatus OX=5053 GN=rhgA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000359	0.999613	CS pos: 18-19. Pr: 0.9768

TMHMM  Annotations     

There is no transmembrane helices in FOXG_04765-t26_2-p1.