CAZyme Information: FOXG_02920-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_02920-t26_1-p1
• CAZy Family: AA7
• CAZyme Description: chitosanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
233	CM000596.1|CGC22	24719.25	4.8530

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000596.1:758782-759579(-)

Full Sequence      

MHSYTIITTLTLSTAASAYQLPQNLKSIYDNHKAGSCSNRLSDRFPEGARYCGDIPGAVF
LKGSDGNYDNMDIDCDGANNHAGACSNDPTGQGETAFKDTVNQYGISDLDANIHPYVVFG
NEGASPSFDPQQHGIKPLSVMAVVCNGEVHYGIWGDTNGGTSTGEASISLAELCFPNQGL
NGDMGHGEKDVLYLAFRGDEAVPGKNGADWKTTSRANFSKSIRALGDKLVAKL

Enzyme Prediction     

EC	3.2.1.132:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH75	7	231	1.6e-84	0.9818181818181818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399960	Glyco_hydro_75	6.61e-102	71	232	1	165	Fungal chitosanase of glycosyl hydrolase group 75. This family consists of several fungal chitosanase proteins. Chitin, xylan, 6-O-sulphated chitosan and O-carboxymethyl chitin are indigestible by chitosanase. EC:3.2.1.132. The mechanism is likely to be inverting, and the probable catalytic neutrophile base is Asp, with the probable catalytic proton donor being Glu. (see the Chitosanase web-page from CAZY).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD56405.1|GH75	1.86e-164	1	233	1	227
QGI66296.1|GH75	3.12e-158	1	233	1	233
QGI97180.1|GH75	3.12e-158	1	233	1	233
QGI83540.1|GH75	3.12e-158	1	233	1	233
CCT70428.1|GH75	2.74e-140	1	233	1	250

PDB Hits     

FOXG_02920-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WB37|CSN_ASPFU	7.08e-106	16	233	16	240	Endo-chitosanase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=csn PE=3 SV=1
sp|Q875I9|CSN_ASPFM	9.14e-101	7	233	6	236	Endo-chitosanase OS=Neosartorya fumigata OX=746128 GN=csn PE=1 SV=1
sp|Q2U1H5|CSNB_ASPOR	7.82e-98	7	233	6	239	Endo-chitosanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csnB PE=3 SV=1
sp|Q2U3M5|CSN_ASPOR	1.47e-96	7	233	6	243	Endo-chitosanase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csn PE=3 SV=1
sp|Q9P961|CSN_ASPOZ	1.47e-96	7	233	6	243	Endo-chitosanase OS=Aspergillus oryzae OX=5062 GN=csn PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000571	0.999375	CS pos: 18-19. Pr: 0.9646

TMHMM  Annotations     

There is no transmembrane helices in FOXG_02920-t26_1-p1.