CAZyme Information: FOXG_02663-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_02663-t26_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
573		65193.48	5.4664

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000596.1:39235-41165(+)

Full Sequence      

MLLYLLALILFIVLAQAESSISTVVQSKTASPEIAVAPSLTPTFRDPHAPNPQKCPGYKA
TNIKRDLKGVKADLTIAGPNCQAFGNDIRDLVLEVKYQTKERLNVKIFPKYLSEQNKTQY
ILPESLVFEPGRDEKTTISNSDLRFDFTNSPSFQFKITRSCNREVLFSTYGHVIVFEDQF
IELVTNMEPDYNVYGLAENIHDFHLGQNFTQTFWTNDAGIEHGNPIDGNIYGVHPFYQQS
RYHKGSNTTSHGVYARNAHGQEWLLRSKTLTYRTIGGSVDIYFLSGQNKQGGSTAIETMR
QYHAGCVGLPAMQMFWTLGFHQCRLGYDTLDKIEAVVENYRAADIPLEAIWSDFDMFDGF
RSFANNLVTFPPDRMSKWVDWLHENEQYYVPLVWANIYRPNPDDPKDTYGPYERGAKLKA
FIRDPESGDFYTGNNWPGFVVWGDFMLPETHKWWAEELKIWYDSVPYDGMLSDLTEPASY
CVGPCGNSRLDMNPVHVPFLIPGEKLRMFYEYPDGFSVTNRSEAEMAKELAANQSAEVQA
AHVFQVPATSTLGRTEPTPGVRNLTYPPYVLNK

Enzyme Prediction     

No EC number prediction in FOXG_02663-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	292	533	3e-39	0.4707259953161593

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269888	GH31_MGAM_SI_GAA	1.35e-75	308	494	1	180	maltase-glucoamylase, sucrase-isomaltase, lysosomal acid alpha-glucosidase. This subgroup includes the following three closely related glycosyl hydrolase family 31 (GH31) enzymes: maltase-glucoamylase (MGAM), sucrase-isomaltase (SI), and lysosomal acid alpha-glucosidase (GAA), also known as acid-maltase. MGAM is one of the two enzymes responsible for catalyzing the last glucose-releasing step in starch digestion. SI is implicated in the digestion of dietary starch and major disaccharides such as sucrose and isomaltose, while GAA degrades glycogen in the lysosome, cleaving both alpha-1,4 and alpha-1,6 glucosidic linkages. MGAM and SI are anchored to small-intestinal brush-border epithelial cells. The absence of SI from the brush border membrane or its malfunction is associated with malabsorption disorders such as congenital sucrase-isomaltase deficiency (CSID). The domain architectures of MGAM and SI include two tandem GH31 catalytic domains, an N-terminal domain found near the membrane-bound end, and a C-terminal luminal domain. Both of the tandem GH31 domains of MGAM and SI are included in this family. The domain architecture of GAA includes an N-terminal TFF (trefoil factor family) domain in addition to the GH31 catalytic domain. Deficient GAA expression causes Pompe disease, an autosomal recessive genetic disorder also known as glycogen storage disease type II (GSDII).
395838	Glyco_hydro_31	2.07e-49	292	496	5	199	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
407105	NtCtMGAM_N	4.17e-37	69	187	1	110	N-terminal barrel of NtMGAM and CtMGAM, maltase-glucoamylase. NtCtMGAM_N is a beta-barrel-like structure just N-terminal to the catalytic domain of maltase-glucoamylase in eukaryotes. It contributes to the architecture of the substrate-binding site, by donating a loop that comes into close contact with two regions in the catalytic domain thereby creating the site. This family is frequently found at the N-terminus of Glycosyl hydrolase 31, pfam01055.to which it contributes as above.
224418	YicI	1.23e-32	55	487	27	426	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
269890	GH31_glucosidase_II_MalA	2.46e-31	308	478	1	161	Alpha-glucosidase II-like. Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities. Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This subgroup also includes the MalA alpha-glucosidase from Sulfolobus solfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD56661.1|GH31	0.0	1	572	1	572
QGI83780.1|GH31	0.0	1	572	1	540
QGI66538.1|GH31	0.0	1	572	1	540
CCT70700.1|GH31	0.0	1	572	1	516
QGI97428.1|GH31	0.0	1	572	1	506

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W37_A	4.90e-59	57	497	44	494	Sugar beet alpha-glucosidase with acarbose [Beta vulgaris],3W38_A Sugar beet alpha-glucosidase [Beta vulgaris],3WEL_A Sugar beet alpha-glucosidase with acarviosyl-maltotriose [Beta vulgaris],3WEM_A Sugar beet alpha-glucosidase with acarviosyl-maltotetraose [Beta vulgaris],3WEN_A Sugar beet alpha-glucosidase with acarviosyl-maltopentaose [Beta vulgaris],3WEO_A Sugar beet alpha-glucosidase with acarviosyl-maltohexaose [Beta vulgaris]
5KZW_A	2.84e-52	52	503	52	472	Crystal structure of human GAA [Homo sapiens],5KZX_A Crystal structure of human GAA [Homo sapiens]
2QLY_A	3.78e-52	79	503	73	475	Crystral Structure of the N-terminal Subunit of Human Maltase-Glucoamylase [Homo sapiens],2QMJ_A Crystral Structure of the N-terminal Subunit of Human Maltase-Glucoamylase in Complex with Acarbose [Homo sapiens],3CTT_A Crystal complex of N-terminal Human Maltase-Glucoamylase with Casuarine [Homo sapiens]
3L4T_A	3.90e-52	79	503	73	475	Crystal complex of N-terminal Human Maltase-Glucoamylase with BJ2661 [Homo sapiens],3L4U_A Crystal complex of N-terminal Human Maltase-Glucoamylase with de-O-sulfonated kotalanol [Homo sapiens],3L4V_A Crystal complex of N-terminal Human Maltase-Glucoamylase with kotalanol [Homo sapiens],3L4W_A Crystal complex of N-terminal Human Maltase-Glucoamylase with miglitol [Homo sapiens],3L4X_A Crystal complex of N-terminal Human Maltase-Glucoamylase with NR4-8 [Homo sapiens],3L4Y_A Crystal complex of N-terminal Human Maltase-Glucoamylase with NR4-8II [Homo sapiens],3L4Z_A Crystal complex of N-terminal Human Maltase-Glucoamylase with Salacinol [Homo sapiens]
5NN3_A	5.21e-52	52	503	50	470	Crystal structure of human lysosomal acid-alpha-glucosidase, GAA [Homo sapiens],5NN5_A Crystal structure of human lysosomal acid-alpha-glucosidase, GAA, in complex with 1-deoxynojirimycin [Homo sapiens],5NN6_A Crystal structure of human lysosomal acid-alpha-glucosidase, GAA, in complex with N-hydroxyethyl-1-deoxynojirimycin [Homo sapiens],5NN8_A Crystal structure of human lysosomal acid-alpha-glucosidase, GAA, in complex with acarbose [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12558|AGLU_ASPOR	3.13e-144	19	572	27	586	Alpha-glucosidase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=agdA PE=2 SV=1
sp|P56526|AGLU_ASPNG	7.93e-141	18	572	22	585	Alpha-glucosidase OS=Aspergillus niger OX=5061 GN=aglA PE=1 SV=1
sp|Q9URX4|YFZB_SCHPO	1.71e-117	27	572	43	595	Uncharacterized family 31 glucosidase C1039.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1039.11c PE=3 SV=1
sp|O74254|AMYG_CANAL	9.16e-117	12	572	17	554	Glucoamylase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GAM1 PE=1 SV=3
sp|Q9C0Y4|AGLU_SCHPO	3.31e-106	55	572	60	573	Alpha-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=agl1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000245	0.999736	CS pos: 17-18. Pr: 0.9797

TMHMM  Annotations     

There is no transmembrane helices in FOXG_02663-t26_1-p1.