CAZyme Information: FOXG_02657-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_02657-t26_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
416		46055.88	7.0609

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000596.1:27115-28680(+)

Full Sequence      

MPIRIGGTTQDRATYDPALKGYVSYSVNDPLEAPMSLTYGPKFFDLIKKFGSETILGFNR
GLNNRTNTFAAVLKAKEKVAKYLWAIELGNEPDLYWKYWQYPVAEAPWNETQEGDSAADW
AQDFIYHWKSPLPILAGGGYAIPFEIEPNWPNLPYLIENSYNKTVRDATKVYNGHLYAFS
NATADDLGPEMKHQRVVQDLNLLPISSAKAAGRPYILGETGFHGLDYEMDSTFGSAIQTT
DKTLRALTLGIQRLFYHQGTINQAFFNWWWSDHVNAPFYGAYFGALAVAGGDSIVASDDG
TDPYAQYIVYKNGKAFKAVLINTDYYSGSGTRSETKFTLTGLKGNSVKALRMTGPSSETT
VPVTQTKSSPQPSIGGQSFSNKNCELGGKQNTEKLSVKKGKLEVTLKASEAMIVYL

Enzyme Prediction     

EC	3.2.1.31:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH79	2	354	1.2e-33	0.8153846153846154

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407104	Glyco_hydro_79C	4.58e-22	307	413	2	103	Glycosyl hydrolase family 79 C-terminal beta domain. This domain is found at the C-terminus of glycosyl hydrolase family 79 proteins. It's function is not yet known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD56667.1|GH79	2.63e-305	1	416	74	489
CCT70706.1|GH79	9.11e-290	1	416	74	489
QGI83786.1|GH79	9.11e-290	1	416	74	489
QGI97434.1|GH79	9.11e-290	1	416	74	489
QGI66544.1|GH79	9.11e-290	1	416	74	489

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7DFQ_A	1.15e-71	2	416	59	459	Chain A, 4-O-alpha-L-rhamnosyl-beta-D-glucuronidase [Fusarium oxysporum],7DFS_A Chain A, 4-O-alpha-L-rhamnosyl-beta-D-glucuronidase [Fusarium oxysporum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QEQ6|GUS79_ASPNC	2.53e-18	3	333	94	447	Beta-glucuronidase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=An02g11890 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000023	0.000021

TMHMM  Annotations     

There is no transmembrane helices in FOXG_02657-t26_1-p1.