CAZyme Information: FOXG_02457-t26_2-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_02457-t26_2-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
418		42860.92	3.7275

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000593.1:4292704-4293960(-)

Full Sequence      

MKNAAALLTLLPLVAAHGFVKSPPPRKPGNAFKAACGEQPFYQQSADINGNVQGIKQVVG
SNFDAKDCNLWLCKGFQFDDNKDNVQSYKLGEKIDFDVNIAAPHTGYANVSVVKTSTDKM
IGEPLIEFENYAANAGLNPNNTAFSVTLPESLGGECTKAGDCVLQWFWDAPDIDQTYESC
VDFVVGAGSGSGSGSGSTKPSSAASAAPVATSAPAAEKPATTLEAVAVTSSALGPVFESV
TTAVPEPTAAAPDAGDDEDCDDEEPVDEGDDEDCDDEDEPTPSAAAATGDDEDCDEDEEP
ETGDDEECPADDGDEYDTQPATPSNSAQGISAAANTAAVTKTQNNAYPVPKPTGKSSSDK
TGSGSKGSNNNAGSNNNYGNAGSNNNNAGSNTVVTSYVTVAAETHYVTVTADAPACTA

Enzyme Prediction     

No EC number prediction in FOXG_02457-t26_2-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA16	17	183	1.1e-71	0.9940119760479041

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397269	LPMO_10	3.22e-09	17	183	1	186	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD50697.1|AA16	6.29e-212	1	418	1	404
QGI93558.1|AA16	9.89e-211	1	365	1	367
QGI62665.1|AA16	5.70e-210	1	365	1	367
CCT66471.1|AA16	3.83e-207	1	367	1	365
CEF84218.1|AA16	1.50e-117	1	218	1	213

PDB Hits     

FOXG_02457-t26_2-p1 has no PDB hit.

Swiss-Prot Hits     

FOXG_02457-t26_2-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000368	0.999592	CS pos: 16-17. Pr: 0.9695

TMHMM  Annotations     

There is no transmembrane helices in FOXG_02457-t26_2-p1.