CAZyme Information: FOXG_01901-t26_3-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_01901-t26_3-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
751		82024.32	5.3123

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000593.1:2531161-2533577(+)

Full Sequence      

MTVPQPISPLPQAPIATALPDAPPNDFFSPIQWDVFFALVDGVLPSITSESDVTDYQGQI
QLPDHEVNAVLNRSAEALAAPATRDNIRAFLRDRPVNDARFRDNLMRTLAISPPDQLKRL
AGLLSLMSTRPGSYFITGYWQPIYNQPAHVREAILKSWVTSPKERWSTLAKTMSAMSFKA
YSQTSSALYQLSGYSDAPKDWQPKETFEYDFLQIEPGDDAHAIETDVVIIGSGCGGGVCA
KNLAEAGHKVIVVDKAYHYPSTQLPMAQDAACAHLYDNAGFFMTEDSGCTVTSGSAWGGG
GTVNWSVCLKPQDFVREEWADEGLPFFTSAEFDECLDRVWEFQGAGTDQIRHNHRNRVLL
NGSSKLGWTARPAPVNTGGREHFCGQCHLGCGLAEKRGPAVSWLPDAAKAGAQFMEGFQV
DKILFDYDGQTAIGIEGEWVSRDSAGDMSDSNNRIKRRVIVRAKKVILAAGSLWSPIVLK
NSGITNPNVGANLHLHPCNFVTAVWKEETIPWEGGIITSYCPQFDNVDGSGYGTKLETTC
MVPFTILSQPSWTSGLDAKLHMTKLRHMNAWISLTRDRDAGSVFPDPTTGRPRIDYTPSD
FDRAHTIQGVEALAKICYVTGAVEIRPLLKGLEPFVRRGEASSEHSLDSKGSVADPETTD
PAFAAWLDRVREVGNKPPTAPWSSAHQMGTCRMSASSDEGVVDEKGRVWGTDNLYVADGS
VFPSASGVNPMITIMAIADRISRGVDADLRA

Enzyme Prediction     

No EC number prediction in FOXG_01901-t26_3-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	221	743	5.2e-75	0.9653284671532847

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
366272	GMC_oxred_N	2.78e-56	275	498	4	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
225186	BetA	7.32e-41	218	751	1	539	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	2.27e-32	585	741	12	143	GMC oxidoreductase. This domain found associated with pfam00732.
235000	PRK02106	3.03e-07	686	744	473	533	choline dehydrogenase; Validated
274143	pyranose_ox	5.64e-06	680	749	477	546	pyranose oxidase. Pyranose oxidase (also called glucose 2-oxidase) converts D-glucose and molecular oxygen to 2-dehydro-D-glucose and hydrogen peroxide. Peroxide production is believed to be important to the wood rot fungi in which this enzyme is found for lignin degradation.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK96886.1|AA3	2.57e-204	13	749	10	734
USW51778.1|AA3_1|AA8|CBM1	3.34e-14	226	745	270	798
ADT70776.1|AA3_1|AA8|1.1.99.18	5.38e-14	226	742	245	777
AUS45831.1|AA3_1|AA8|CBM1	1.26e-13	226	745	253	785
AGE97206.1|AA3_1|AA8	9.79e-12	217	740	226	760

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QI4_A	2.97e-08	223	742	6	539	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides],4QI5_A Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
4QI6_A	3.50e-08	223	742	228	761	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
4QI7_A	2.38e-07	223	739	228	757	Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A],4QI7_B Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A]
1CF3_A	4.67e-07	219	748	14	578	GLUCOSE OXIDASE FROM APERGILLUS NIGER [Aspergillus niger],1GAL_A CRYSTAL STRUCTURE OF GLUCOSE OXIDASE FROM ASPERGILLUS NIGER: REFINED AT 2.3 ANGSTROMS RESOLUTION [Aspergillus niger],3QVP_A Crystal structure of glucose oxidase for space group C2221 at 1.2 A resolution [Aspergillus niger],3QVR_A Crystal structure of glucose oxidase for space group P3121 at 1.3 A resolution. [Aspergillus niger]
5NIW_A	8.08e-07	219	748	12	576	Glucose oxydase mutant A2 [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B5WWZ9|FAO2_LOTJA	7.97e-86	221	750	235	747	Long-chain-alcohol oxidase FAO2 OS=Lotus japonicus OX=34305 GN=FAO2 PE=2 SV=1
sp|B5WWZ8|FAO1_LOTJA	7.59e-78	223	745	235	740	Long-chain-alcohol oxidase FAO1 OS=Lotus japonicus OX=34305 GN=FAO1 PE=1 SV=1
sp|Q9LW56|FAO3_ARATH	3.67e-77	219	742	227	733	Long-chain-alcohol oxidase FAO3 OS=Arabidopsis thaliana OX=3702 GN=FAO3 PE=1 SV=1
sp|Q94BP3|FAO4B_ARATH	3.74e-76	215	742	228	735	Long-chain-alcohol oxidase FAO4B OS=Arabidopsis thaliana OX=3702 GN=FAO4B PE=2 SV=2
sp|O65709|FAO4A_ARATH	1.05e-69	218	738	217	711	Long-chain-alcohol oxidase FAO4A OS=Arabidopsis thaliana OX=3702 GN=FAO4A PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000001

TMHMM  Annotations     

There is no transmembrane helices in FOXG_01901-t26_3-p1.