CAZyme Information: FOXG_01365-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_01365-t26_1-p1
• CAZy Family: AA3
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
851		92902.08	5.8089

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000589.1:5819337-5821991(-)

Full Sequence      

MRYARMDVEALIQQLTLEEKVQLTAGVGWWHTAAIERLSIPPIRLSDGPNGVRGTHFFDS
TPSSCLPCGTALGATWNTDLIHRLGRLLSDEAHAKGAHVLLGPTVNIQRGPLGGRGFESF
SEDPILSGILAGHYVHGVQKNGVSATMKHFACNDMESARMAVDVQITERALREVYLLPFM
IAVEMASPRVFMTAYNKVNGTHAPDNHHLLQDILRDEWKWDGLVVSDWFGTYSTTEAINA
GQDLEMPGPTRWRGETLVHAVTSNKVKRSTLDERVRNILKLVKHSMENTSIPPNAPETQL
QSEENSRLLREAAAESVVLLKNDKGVLPLDPAKPVAVIGPNADISTYCGGGSASLRAYHT
VSPLEGIRGIAKDVSFTKGLYGHRSLPQIGKLLKTVGEQRQGFTLRIYNDPPPSSGPDTR
KVLETRILDDSNIWFVDYEHPALEQIWYADIEGVLTPEKTGEWDFGLCVHGTGELFIDGE
LVVSNVVDQKPGSSFLGCGTVEKTGSRMLEGGKSYNVVVRWGCDKTSDLKVSGVVDFGQG
GMRLGGCPRLEPRQALQDAVELAKSVDQVVLCVGTSGEWESEGQDRANMSLPPGSDDLIS
AVLQANPNTVVLIQSGTPVSMPWVDQASTIAQAWFGGNEAGNGIADVLFGAMNPSGKLPI
TMPRRVSDNPSALSFRSECGRVLYSEDVHVGYRWYDTLDIEPLFPFGHGLSYTTFTLSDL
RVEEHGESESKKLIVSVNVTNTGSRSGAAVVQVYVKPPHPTPLTASALDTITRSSKELKG
FAKINLVPGANGRAKVELDVLRATSYWSEREDYWCSDAGDYTVLVGMSSRCEFLDKTFTV
QNATTWRGLRT

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	33	247	3.1e-65	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.15e-89	37	830	101	755	beta-glucosidase BglX.
224389	BglX	1.51e-77	32	373	50	389	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	5.09e-55	317	712	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.57e-40	37	281	63	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	2.60e-40	10	799	55	743	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD46578.1|GH3	0.0	27	851	1	825
CCT63210.1|GH3	0.0	6	850	1	845
QGI90581.1|GH3	0.0	6	850	1	845
QGI59669.1|GH3	0.0	6	850	1	845
QGI76869.1|GH3	0.0	6	850	1	830

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	2.39e-253	4	849	2	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.60e-248	4	849	2	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.56e-142	6	842	3	670	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.34e-119	12	830	9	653	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.67e-106	8	840	4	713	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WU49|BGLI_ASPFU	0.0	5	849	3	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	0.0	5	849	3	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	0.0	5	849	3	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q0CAF5|BGLI_ASPTN	0.0	5	849	3	839	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	0.0	5	849	3	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000024	0.000005

TMHMM  Annotations     

There is no transmembrane helices in FOXG_01365-t26_1-p1.