CAZyme Information: FOXG_00906-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_00906-t26_1-p1
• CAZy Family: AA1|AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
535		60221.90	6.8218

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000589.1:4464915-4466622(-)

Full Sequence      

MAESHEFRRRVLLLVTTGGFTHAAPVLEIGAVLASRGHDVQFATCAGQEDWTINYPFIKT
VYTVGPAASEDDLDLHYETMRLWRHEHGFGPMMKSKYFFDNFWTDTYKSLRSLCEDGSTR
PDFIVADFFADSAARDMLTQFNIQLASVWPQMPYAMAPVSYHPGQPGFQADGALTSEHAS
LSSRFWNEFVVLAALPTIIPWLIWTKRMRVDAGVNYRHSLLSKPDYLVLVNSFWGLEAPK
ELPPLMAPVGPILSDEYLPLDEDLTQFLSSHDRTIYYLLGFIQALDDDSINGVIWSIPQK
PRANFDTFKSYNLSDGSSISITDLLNDSHPRFRLPIFAPQRAILAHPNTVLFLTHGGGSS
ANETLFHGTPVLAIGYFFDQLCNSARLKAAGVGISLDKSYLTPSSISSAIASIIADKDGS
FAMNVRRMQGIATLNSKRKHLATDLIEEVMIDQELRFKNGVELRPMHLQTADMRMPIWKA
RNWDMWFISLTGLAAGGVASWWFVTNGWKKLPVILTRSMRISRGFAREMFDSRRA

Enzyme Prediction     

No EC number prediction in FOXG_00906-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	120	429	2.4e-26	0.7041884816753927

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	5.10e-32	13	403	4	362	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
278624	UDPGT	2.61e-11	229	402	230	394	UDP-glucoronosyl and UDP-glucosyl transferase.
224732	YjiC	3.28e-11	8	403	1	355	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
223071	egt	9.58e-09	248	397	262	413	ecdysteroid UDP-glucosyltransferase; Provisional
178572	PLN02992	1.11e-06	332	399	340	408	coniferyl-alcohol glucosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD47039.1|GT1	0.0	1	535	1	551
QGI59140.1|GT1	0.0	1	535	1	551
QGI90050.1|GT1	0.0	1	535	1	551
CCT62669.1|GT1	0.0	1	535	1	551
QGI76352.1|GT1	0.0	1	521	1	535

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IPB_A	1.30e-15	250	416	19	176	Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_B Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_C Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_D Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens]
7CJX_A	3.48e-15	259	416	7	155	Chain A, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_B Chain B, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_C Chain C, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_D Chain D, UDP-glucuronosyltransferase 2B15 [Homo sapiens]
2O6L_A	3.30e-12	262	431	12	167	Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens],2O6L_B Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens]
6PNT_A	1.74e-07	337	455	324	437	Structural Characterization of UDP-glycosyltransferase from Tetranychus Urticae [Tetranychus urticae]
6JTD_A	4.36e-07	334	427	351	449	Crystal structure of TcCGT1 in complex with UDP [Trollius chinensis],6JTD_B Crystal structure of TcCGT1 in complex with UDP [Trollius chinensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36514|UD2C1_RABIT	3.97e-18	229	431	230	421	UDP-glucuronosyltransferase 2C1 (Fragment) OS=Oryctolagus cuniculus OX=9986 GN=UGT2C1 PE=2 SV=1
sp|P08541|UD2B2_RAT	7.66e-17	13	414	26	434	UDP-glucuronosyltransferase 2B2 OS=Rattus norvegicus OX=10116 GN=Ugt2b PE=1 SV=1
sp|P19488|UDB37_RAT	1.35e-16	229	466	258	480	UDP-glucuronosyltransferase 2B37 OS=Rattus norvegicus OX=10116 GN=Ugt2b37 PE=1 SV=1
sp|Q6K1J1|UDB31_CANLF	3.17e-16	218	431	248	449	UDP-glucuronosyltransferase 2B31 OS=Canis lupus familiaris OX=9615 GN=UGT2B31 PE=1 SV=1
sp|P36511|UDB15_RAT	3.17e-16	229	414	258	434	UDP-glucuronosyltransferase 2B15 OS=Rattus norvegicus OX=10116 GN=Ugt2b15 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.869966	0.130052

TMHMM  Annotations     

Start	End
483	505