CAZyme Information: FOXG_00621-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_00621-t26_1-p1
• CAZy Family: AA12
• CAZyme Description: dolichyl-diphosphooligosaccharide-protein glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
749	CM000589.1|CGC18	83336.87	8.9716

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000589.1:3570543-3573078(-)

Full Sequence      

MAVKTAKTEDVLAGVNGQNTRTLLRVIILLLIAGAAVSSRLFSVIRFESIIHEFDPWFNF
RATKYLVANGFYKFWDWFDDRTWHPLGRVTGGTLYPGLMVTSGVIYHALRALTVPVDIRN
ICVLLAPAFSGLTAYAAYLLTNEMTTSSSAGLLAAVFMGIAPGYISRSVAGSYDNEAIAI
FLLVLTFYLWVKALKLGSMLWGALCALSYAYMVASWGGYAFITCLLPVHAFVLICMGRYS
DRLYVSYTTWYAIGTMASFQVPFVGFLCVKTNEHMPALGVFGLLQVIAFIVYVKSVIPGR
QITTIVVAAGVATFFVGLAGLILLTSFGYIAPWGGRFYSLFDTGYAKIHIPIIASVSEHQ
PTAWPSFFFDLNFLIWLFPAGVYMCFQNLADEHVFIVVYALFASYFAGVMVRLMLTLTPV
VCVAAAMAASQLLDTYLRVNQPEPTQAAQGEAVDGSKKAKGALRATAKPDVGIYTTLSKI
TVVAGMVIYLVMFVTHCTWVTSNAYSAPSVVLSSRRMDGSPVIIDDYREAYQWLRQNTGK
DAKIMSWWDYGYQIGGMADRPTLVDNNTWNNTHIATVGKAMSSREEVSYPIMRQHEVDYV
LVVFGGVLGYSGDDINKFLWMVRIAEGIWPDEVKERNFFTERGEYRVDAGATETMKNSLM
YKMSYHNFNKTNSPGKIVDRVRGVKMPDTSPTLDVLEEAFTSENWLIRIYKVKDLDNVGR
DHFEAGAFSRGQKKKKAVQKRGARVLRVD

Enzyme Prediction     

EC	2.4.99.18:21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT66	24	672	1.6e-189	0.8542568542568543

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396873	STT3	1.67e-138	33	506	11	478	Oligosaccharyl transferase STT3 subunit. This family consists of the oligosaccharyl transferase STT3 subunit and related proteins. The STT3 subunit is part of the oligosaccharyl transferase (OTase) complex of proteins and is required for its activity. In eukaryotes, OTase transfers a lipid-linked core-oligosaccharide to selected asparagine residues in the ER. In the archaea STT3 occurs alone, rather than in an OTase complex, and is required for N-glycosylation of asparagines.
224206	Stt3	2.96e-98	33	739	28	756	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].
275016	archaeo_STT3	2.08e-25	53	561	32	547	oligosaccharyl transferase, archaeosortase A system-associated. Members of this protein family occur, one to three members per genome, in the same species of Euryarchaeota as contain the predicted protein-sorting enzyme archaeosortase (TIGR04125) and its cognate protein-sorting signal PGF-CTERM (TIGR04126).
396786	PMT	3.29e-04	129	271	92	238	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
404170	PMT_2	0.009	124	208	26	107	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD47338.1|GT66	0.0	1	749	1	749
QGI58960.1|GT66	0.0	1	749	1	749
QGI89870.1|GT66	0.0	1	749	1	749
QGI76175.1|GT66	0.0	1	749	1	749
CCT62497.1|GT66	0.0	1	749	1	749

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6C26_A	7.52e-308	21	748	13	718	The Cryo-EM structure of a eukaryotic oligosaccharyl transferase complex [Saccharomyces cerevisiae S288C],6EZN_F Cryo-EM structure of the yeast oligosaccharyltransferase (OST) complex [Saccharomyces cerevisiae S288C],7OCI_F Chain F, Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 [Saccharomyces cerevisiae S288C]
6S7T_A	3.14e-274	21	717	69	777	Cryo-EM structure of human oligosaccharyltransferase complex OST-B [Homo sapiens]
6FTG_5	3.26e-256	22	719	16	701	Subtomogram average of OST-containing ribosome-translocon complexes from canine rough microsomal membranes [Canis lupus familiaris],6FTI_5 Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Programmed 80S Ribosome [Canis lupus familiaris]
6S7O_A	6.54e-256	22	719	16	701	Cryo-EM structure of human oligosaccharyltransferase complex OST-A [Homo sapiens]
6FTJ_5	1.79e-253	22	714	16	696	Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Non-programmed 80S Ribosome [Canis lupus familiaris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94335|STT3_SCHPO	6.40e-312	24	735	24	738	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit stt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=stt3 PE=3 SV=1
sp|P39007|STT3_YEAST	3.87e-307	21	748	13	718	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STT3 PE=1 SV=2
sp|P46975|STT3_CAEEL	4.92e-278	22	717	18	720	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit stt-3 OS=Caenorhabditis elegans OX=6239 GN=stt-3 PE=1 SV=1
sp|Q3TDQ1|STT3B_MOUSE	1.27e-274	21	717	66	774	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Mus musculus OX=10090 GN=Stt3b PE=1 SV=2
sp|Q8TCJ2|STT3B_HUMAN	1.62e-273	21	717	69	777	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Homo sapiens OX=9606 GN=STT3B PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999981	0.000003

TMHMM  Annotations     

Start	End
23	45
86	108
121	139
149	171
178	200
215	237
244	266
276	298
305	327
364	386
393	415
471	493