CAZyme Information: FOMG_19749-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOMG_19749-t38_1-p1
• CAZy Family: GT66
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
480		52381.01	5.3898

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum26406	20033	1089452	372	19661

• Gene Location: location=KI980835.1:539-2104(+)

Full Sequence      

MADTIDVEALIKKLSIPEKIDLLTGLDYWHTRPLPKHGIPSIRLSDGPNGVRGIKFFDGV
KAACFPCGTALGATFNTPLLEEAGRKMGEETKLKGAHCLLSPAINMQRAPVGGRGFESIG
EDPVLAGLGAAALCRGIESTGVLSTPKHWICNDQEHRRNAVLSIVTERALREIYALPFQL
TMRDSDPGAIMTGYNGLNDAYCSENRDILDTLLRKEWGWKGMIMSDWYGTYSTNDAINAG
LDLEMPGPSRFRGDLLKFNVATDKVNEHTIDERARPILNFIKKAMALGIPENAPEMTGDT
PETAELLRRIGGETLVLLKNENNILPLKKDKKTVVIGPNAKIATYQGGGSAAVPAYYAVT
PFDGIRQKLKSPPSYAAGAYTHKLLPLLGNVVKTASGDQGMTMKAYTQPPGAENRVVVDD
RILSKSEMLLSDYYNDQIKDPLWYAEFEGSFVAEEDCEFELGLIVCGSAKLFVNDELAGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	35	246	2.8e-58	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	1.06e-58	35	361	56	382	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	2.86e-32	65	279	88	315	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	8.46e-27	9	378	55	466	Probable beta-xylosidase; Provisional
185053	PRK15098	6.41e-26	65	379	120	462	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	4.93e-20	315	386	1	71	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC84651.1|GH3	5.94e-270	1	477	1	476
QBZ56956.1|GH3	2.25e-237	5	477	13	486
CEI66560.1|GH3	3.20e-229	1	477	1	475
CEF74963.1|GH3	1.29e-228	1	477	1	475
CZS78241.1|GH3	1.29e-228	1	477	1	475

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	2.75e-137	6	477	5	493	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.24e-131	6	477	5	493	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	9.16e-73	5	370	3	367	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	3.80e-62	7	368	4	388	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
5WAB_A	1.53e-61	11	353	9	354	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DFA8|BGLI_NEOFI	2.67e-181	5	477	4	476	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	4.27e-180	5	477	4	476	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	4.27e-180	5	477	4	476	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	1.58e-177	5	477	4	476	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	8.94e-177	5	477	4	476	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000070	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOMG_19749-t38_1-p1.