CAZyme Information: FOMG_19355-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOMG_19355-t38_1-p1
• CAZy Family: GT62
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
667		71744.88	7.1269

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum26406	20033	1089452	372	19661

• Gene Location: location=KI980503.1:359-2441(-)

Full Sequence      

MRFVSPWEAASSLGSILLMASTVSALATTANSVDTYDYVVVGSGPGGGPLAVNLARAGFR
TLLLEAGDDASDAMITNAIALTNTADTTALTWTYWVRHYDDLELTKKYQHLTWRLPNGNL
WVGPGSSAPEGAEIVGIQYPRGATLGGSSIVNSALTVLPANSDWDYIKNLTGDDSWNATH
MGDLFIKLEKNQYRPRGTPGHGFDGYLETILGNGAVFLSSPQATSVLKAMAAEAGQDPED
LANILNTDPNQVLNPDRDQMTGLVGAPQHANTTWARYSARTRVLDTLRAVDEKGSKKYPL
EVRLNSYATKVLFDKPRGGSVPRAIGLDYLEGKSVFQGDLRYNSTVKKTSRRVLARKEVI
LSGGSFGSPQLLLLSGIGPAADLKALKIPVVADVPGVGRNMQDHNEIAVIGHGAQAFDYS
AAPGGPRSQCTFRAPGDPCLALYRQGQGPYVQPSLMQLGFLKTNYTTNDERDIAIFPGSF
GFRGFWPRNTGQSWDDPPTTWGMHSVHIHGNSTAGYLKLRSADPTMTPEINFRHFNGTGA
AGDIAAIKEFLAWGRRAFNRVQAPFAPYNISWPPCTGTVGADGSCSVTNNDEDFIRENIF
GHHVIGTCAIGPKSDKIAVLDSKFRVRGVSSLRVVDASAFPRSPGAFPVIGVYMLSEKAS
ETILLGE

Enzyme Prediction     

No EC number prediction in FOMG_19355-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	35	664	2.3e-81	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	9.72e-46	50	664	22	534	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.87e-42	140	664	83	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	2.12e-26	515	659	5	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	3.61e-16	140	404	22	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.34e-15	300	655	235	568	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK92979.1|AA3	0.0	1	667	1	667
UPL03392.1|AA3	0.0	1	666	1	640
VBB79663.1|AA3	2.53e-194	31	664	30	659
CDP27995.1|AA3	4.89e-193	31	664	30	654
QRC93226.1|AA3	2.83e-186	17	664	11	663

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F97_A	2.63e-29	36	664	6	528	Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688],6F97_B Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688]
4UDP_A	2.63e-29	36	664	6	528	Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDP_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDQ_A Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688],4UDQ_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688]
4UDR_A	4.90e-28	36	664	6	528	Crystal structure of the H467A mutant of 5-hydroxymethylfurfural oxidase (HMFO) [Methylovorus sp. MP688],4UDR_B Crystal structure of the H467A mutant of 5-hydroxymethylfurfural oxidase (HMFO) [Methylovorus sp. MP688]
6YS2_AAA	5.15e-28	36	660	8	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
3LJP_A	7.37e-28	36	663	14	526	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B8A1|PKFF_EMENI	3.67e-33	35	666	40	610	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|Q6UPE0|CHDH_RAT	6.64e-31	34	663	44	576	Choline dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Chdh PE=1 SV=1
sp|A5VPA6|BETA_BRUO2	2.72e-29	37	664	4	526	Oxygen-dependent choline dehydrogenase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) OX=444178 GN=betA PE=3 SV=1
sp|B0CKN4|BETA_BRUSI	2.72e-29	37	664	4	526	Oxygen-dependent choline dehydrogenase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) OX=470137 GN=betA PE=3 SV=1
sp|Q8G1Z8|BETA_BRUSU	3.64e-29	37	664	4	526	Oxygen-dependent choline dehydrogenase OS=Brucella suis biovar 1 (strain 1330) OX=204722 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.644178	0.355820

TMHMM  Annotations     

There is no transmembrane helices in FOMG_19355-t38_1-p1.