CAZyme Information: FOMG_19273-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOMG_19273-t38_1-p1
• CAZy Family: GT62
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
250		27034.32	6.4922

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum26406	20033	1089452	372	19661

• Gene Location: location=JH659554.1:857-1609(-)

Full Sequence      

MVLLLQAVRNELDAYASKHAPGYHFQLTIAAPVGSSHYSKLRLADLGRIVDYINLMAYDY
AGSWSSVAGHSANLYANTDIPQSTPFNTDDAVKAYLDAGVPSHKLILGMPAYGRSFIGAS
GMGEPHSGVGLPNKALGSWEAGVWDYKALSKQGLEIMYDEKAQAYYGKYQSGGGICSYDT
PETIQKKVSYLKQRGLGGAMFWEASGDGRGQESLVGTSFRSLGNFDQTENLLVYPDSRYR
NIASGMEAGV

Enzyme Prediction     

EC	3.2.1.14:58

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	2	213	1e-48	0.5945945945945946

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214753	Glyco_18	1.27e-65	1	207	128	334	Glyco_18 domain.
119365	GH18_chitinase	3.56e-60	2	207	155	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
395573	Glyco_hydro_18	6.94e-51	1	207	125	307	Glycosyl hydrolases family 18.
119351	GH18_chitolectin_chitotriosidase	4.92e-43	2	202	137	336	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
225862	ChiA	1.01e-42	2	210	197	426	Chitinase, GH18 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD57502.1|GH18	1.46e-176	1	250	179	428
BAB40594.1|GH18	1.48e-107	1	246	183	423
BAB40588.1|GH18	5.96e-107	1	245	183	422
UPL00995.1|GH18	1.31e-106	3	248	187	427
AJY59031.1|GH18	1.43e-106	1	246	80	320

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YLJ_A	1.95e-103	1	246	182	422	Chain A, Endochitinase 42 [Trichoderma harzianum],6YN4_A Chain A, Endochitinase 42 [Trichoderma harzianum],7AKQ_A Chain A, Endochitinase 42 [Trichoderma harzianum]
6EPB_A	1.95e-103	1	246	182	422	Structure of Chitinase 42 from Trichoderma harzianum [Trichoderma harzianum]
3G6L_A	1.81e-89	1	246	165	405	The crystal structure of a chitinase CrChi1 from the nematophagous fungus Clonostachys rosea [Clonostachys rosea],3G6M_A crystal structure of a chitinase CrChi1 from the nematophagous fungus Clonostachys rosea in complex with a potent inhibitor caffeine [Clonostachys rosea]
6IGY_A	9.92e-79	1	245	160	402	Crystal structure of Aspergillus niger chitinase B [Aspergillus niger]
1LL7_A	3.04e-76	2	246	148	390	Chain A, CHITINASE 1 [Coccidioides immitis],1LL7_B Chain B, CHITINASE 1 [Coccidioides immitis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A6N6J0|CHI46_TRIHA	6.18e-103	1	246	183	429	Endochitinase 46 OS=Trichoderma harzianum OX=5544 GN=chit46 PE=1 SV=1
sp|P48827|CHI42_TRIHA	2.29e-101	1	246	182	422	Endochitinase 42 OS=Trichoderma harzianum OX=5544 GN=chit42 PE=1 SV=1
sp|E9ERT9|CHI1_METRA	8.74e-99	1	246	183	423	Endochitinase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chit1 PE=3 SV=1
sp|P32470|CHI1_APHAL	1.56e-96	1	246	182	422	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2
sp|O14456|CHI1_METAN	7.66e-89	1	246	183	422	Endochitinase 1 OS=Metarhizium anisopliae OX=5530 GN=chit1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000073	0.000001

TMHMM  Annotations     

There is no transmembrane helices in FOMG_19273-t38_1-p1.