CAZyme Information: FOMG_18471-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOMG_18471-t38_1-p1
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1003	JH659447.1|CGC1	111983.69	4.9458

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum26406	20033	1089452	372	19661

• Gene Location: location=JH659447.1:4339-7697(-)

Full Sequence      

MTLVKAQPPLNNGHVKNEAKEWAQDKLSQMTLEEKVLLLAGEDLWRTNAIPRLGISRIKT
SDGPVGVRGGIFTDGVSAASAPTGVSLAATWDLSVIRDVCSVLIHEAKSKEVDVLLGPTV
CIPRTPLGGRNFEAYSEDPYLTGKIAGEFINRLQDAGIGACIKHLAANDQETRRFFIDEK
IPDRALREIALQPFQIAIRDSNPWTVMTAYNKINGTFCSAHEFLIQDVLRKEWGWDGLVM
SDWFGTNSVVPSVKAGLDLEMPGPVRRRGKHLIDAYQKGLVDLSFIDASASRVLELVHKV
GKSNIPDWKEGQEKADDLPEHRAIFRRAGAEGIVLLKNSAKLLPLSNLDGRRIAILGPNA
LRSVATGGGSSNLAPHYRTTPYQSIKSEIAAKFPTAKVHAHAGILTHRYIPLVDQDVMTN
PETGKPGFQLCLYRNMNHGGQPFMVEHRPSSNLVCYDGLPPELTTGERYSYRGRTVLKPK
TTGLHEFSLSSCGPGKLMLDGEVIIDIERHWWSPKSSLFMSYGSPEERVKVYMEAGREYE
LLLESISREPKPYDLDYMAELEREEVQDGGRIGFMENPGDLDRFFQDGIGMARDSDVAIV
VVGKDHEWETETSDMTTGLHEFSLSSCGPGKLMLDGEVIIDIERHWWSPKSSLFMSYGSP
EERVKVYMEAGREYELLLESISREPKPYDLDYMAELEREEVQDGGRIGFMENPGDLDRFF
QDGIGMARDSDVAIVVVGKDHEWETETSDMVSMDLPGRSNEFISAVAAANPNTIVVNQTG
SPITMPWKDKVSAIVQAWYQGQEQGNCLADVLLGTVNPSGKLPITFPKRIEDTPPYDNYP
GENDVVYYGEGIYAGYRFYDHRKIEPLFPFGAGLSYATFEYSNMRISSNEFHEEAGIEVE
VDVTNIGPRDGKEIVQFYVGQINPRLHRPVSELKGWEKVFVPVGQTVTARMKIDKVSLSY
WDDSVAKWVIEKDAEYRVTAAKDSSDEGLTAAFRSPKEYQWVN

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	49	262	5.4e-60	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	1.04e-69	42	391	47	389	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	3.61e-50	712	876	73	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
185053	PRK15098	1.45e-48	690	986	471	756	beta-glucosidase BglX.
395747	Glyco_hydro_3	1.06e-38	52	296	63	316	Glycosyl hydrolase family 3 N terminal domain.
185053	PRK15098	2.03e-31	25	423	40	487	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD62879.1|GH3	0.0	1	1003	1	868
CCT75821.1|GH3	0.0	1	1003	1	887
QGJ01965.1|GH3	0.0	1	1003	1	887
QGI71072.1|GH3	0.0	1	1003	1	887
UPK89362.1|GH3	0.0	1	1003	1	872

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	3.71e-150	27	1001	10	842	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.63e-145	27	1001	10	842	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.12e-113	27	994	9	667	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
4I3G_A	1.77e-82	23	968	54	802	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]
5WAB_A	2.20e-79	27	991	9	659	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	1.10e-184	27	986	15	829	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|Q2U8Y5|BGLI_ASPOR	6.03e-171	27	1002	10	837	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|P27034|BGLS_RHIRD	1.27e-170	25	999	4	814	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	6.58e-170	27	1002	10	837	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|A1CA51|BGLI_ASPCL	8.99e-170	27	1002	10	836	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999922	0.000135

TMHMM  Annotations     

There is no transmembrane helices in FOMG_18471-t38_1-p1.