CAZyme Information: FOMG_18336-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOMG_18336-t38_1-p1
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
429		47974.67	7.0789

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum26406	20033	1089452	372	19661

• Gene Location: location=JH659434.1:16047-17798(-)

Full Sequence      

MQLDRIYGMFGVLRGLGIELPAADYEESLVKVVFQVLCQISRQYSSIQILQFVTGEHSLH
GLPSWIPDYCIVPWSTVQFGHEVGSVEFEPNGTVLSVRGKRLDSIAAVSSTISHLDLHSG
VVTEAFDLSIPTFQAKIRDWLEFITAAHTNQACCQIDIIRRIFQLFIHPQVEACYNEAGA
IPWAYFSSDRLHLHFAHWLADVLDNSQKTPSSHGWDNSFDQVPHFLSSEAVITSHGPESP
HNFDNPFHLNLSDVGYPRAISVLQRWVREYVAQKKLFRTLYPKELQIQVRWWATEVQVTV
QMTLLVKDKPLSSYVVFGTKDFNPQDHGIEPLSVMAVVCRNQVFYGVWGDTNGFRSTGES
SLALARLCFPNEGLNGNKSHGKKGVLFIGFTGKGAVPGANGANWKAKNRCQFQDSLKGLG
DKLVAGLKI

Enzyme Prediction     

EC	3.2.1.132:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH75	313	425	2.9e-47	0.4954545454545455

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399960	Glyco_hydro_75	1.38e-62	313	425	45	164	Fungal chitosanase of glycosyl hydrolase group 75. This family consists of several fungal chitosanase proteins. Chitin, xylan, 6-O-sulphated chitosan and O-carboxymethyl chitin are indigestible by chitosanase. EC:3.2.1.132. The mechanism is likely to be inverting, and the probable catalytic neutrophile base is Asp, with the probable catalytic proton donor being Glu. (see the Chitosanase web-page from CAZY).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UNI17114.1|GH75	4.61e-51	308	427	110	233
AAS77607.1|GH75	3.55e-50	308	428	110	234
QYT03532.1|GH75	3.55e-50	308	428	110	234
QLI64121.1|GH75	3.61e-49	308	427	110	233
UKZ89610.1|GH75	5.62e-48	308	428	110	233

PDB Hits     

FOMG_18336-t38_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q875I9|CSN_ASPFM	9.78e-46	308	428	114	237	Endo-chitosanase OS=Neosartorya fumigata OX=746128 GN=csn PE=1 SV=1
sp|Q4WB37|CSN_ASPFU	4.99e-42	308	427	118	240	Endo-chitosanase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=csn PE=3 SV=1
sp|Q2U1H5|CSNB_ASPOR	1.86e-41	308	428	117	240	Endo-chitosanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csnB PE=3 SV=1
sp|Q2U3M5|CSN_ASPOR	2.17e-40	292	428	105	244	Endo-chitosanase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csn PE=3 SV=1
sp|Q9P961|CSN_ASPOZ	2.17e-40	292	428	105	244	Endo-chitosanase OS=Aspergillus oryzae OX=5062 GN=csn PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000001

TMHMM  Annotations     

There is no transmembrane helices in FOMG_18336-t38_1-p1.