CAZyme Information: FOMG_17829-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOMG_17829-t38_1-p1
• CAZy Family: GT34
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
721		78435.26	7.2969

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum26406	20033	1089452	372	19661

• Gene Location: location=JH659397.1:34936-37333(-)

Full Sequence      

MATRTRIDLPEGPSSGPLTDAQWQVLMAIMDTIIAPCPESTIPAGQTSALLTNCDASTLH
AFLAETPSNMPLFQEILKRLLANLHADKLSAIGTVCSLLGNRAGALTLTGYFTLFCDLSI
QDRTLVLNSWQRSSLATLRVLFKQLSIIGKHVYLRSSTLFNEVVGFPSTPPGWHPVESYP
FEFMQFNNSDYHVQLDTDVVIVGSGCGAGVVARTIAMAGHRVLVVDKGHHFETSSLPLDQ
SAGYFHLFEQGGLVSSEDGSISTLAGSCFGGGGTVNWSACLQLQNTVRDEWADERGLEFF
KSAKFQAHLDSVCERMGVSNEPINQNHGNSVLLEGGRRLGYSAKPVPQNTGNCDHQDGFC
SMGCWMGKKQGPVNGWLPDAARCGAKFMSGFYVNRVLFKNPGGRKVASGVTGTWRPRDGP
DSSARSVTINAKRVVISAGSLCSPIILKNSGLKNKHIGRNLHLHPTSFVSAIFEQETRPW
EGGILTSVVSSFDNIDGHGHGVRLERPAMLPSMCLTWCNWTSGPEYKAMISKYRHMEAYI
AITRDRHSGHVTADPINGTPRLVYTPSKFDVSNNLKGMLALAKILYTQGATEIHPILPGL
EPFIRQQESLSDGAHSPSEAIDPRFSQWLKKMEAHGNKTPDTPYGSAHQMGTCRMSTKEA
DGVVDKFGRVWGCENLIVADASVFPSASGVNPMVTTMAICEHIGLAMAEELARDTQERPR
L

Enzyme Prediction     

No EC number prediction in FOMG_17829-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	194	717	2.4e-45	0.517799352750809

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
366272	GMC_oxred_N	1.04e-63	244	466	1	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
225186	BetA	2.97e-37	198	720	9	542	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	3.37e-27	549	703	5	143	GMC oxidoreductase. This domain found associated with pfam00732.
235000	PRK02106	3.60e-06	648	703	473	527	choline dehydrogenase; Validated
274143	pyranose_ox	1.16e-04	642	698	477	533	pyranose oxidase. Pyranose oxidase (also called glucose 2-oxidase) converts D-glucose and molecular oxygen to 2-dehydro-D-glucose and hydrogen peroxide. Peroxide production is believed to be important to the wood rot fungi in which this enzyme is found for lignin degradation.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK96886.1|AA3	0.0	1	721	8	744
VWO96530.1|AA3_3	9.03e-14	198	711	7	596
QSS52715.1|AA3_3	1.17e-13	196	711	5	597
QSS70720.1|AA3_3	2.04e-13	196	711	5	597
QRD04249.1|AA3_3	1.44e-09	196	711	13	597

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	1.21e-08	394	710	236	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B5WWZ9|FAO2_LOTJA	1.13e-79	194	713	236	748	Long-chain-alcohol oxidase FAO2 OS=Lotus japonicus OX=34305 GN=FAO2 PE=2 SV=1
sp|B5WWZ8|FAO1_LOTJA	4.10e-79	19	714	23	747	Long-chain-alcohol oxidase FAO1 OS=Lotus japonicus OX=34305 GN=FAO1 PE=1 SV=1
sp|O65709|FAO4A_ARATH	3.46e-74	26	713	4	724	Long-chain-alcohol oxidase FAO4A OS=Arabidopsis thaliana OX=3702 GN=FAO4A PE=3 SV=2
sp|Q94BP3|FAO4B_ARATH	5.06e-73	52	716	47	747	Long-chain-alcohol oxidase FAO4B OS=Arabidopsis thaliana OX=3702 GN=FAO4B PE=2 SV=2
sp|Q9LW56|FAO3_ARATH	6.57e-72	18	711	15	740	Long-chain-alcohol oxidase FAO3 OS=Arabidopsis thaliana OX=3702 GN=FAO3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOMG_17829-t38_1-p1.