CAZyme Information: FOMG_17663-t38_3-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOMG_17663-t38_3-p1
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
897		98691.22	8.9941

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum26406	20033	1089452	372	19661

• Gene Location: location=JH659386.1:47344-50236(+)

Full Sequence      

MVFSLTESNGLGNITIKDADSQNITSGNVQADGRVKVQFHQHAQSVVSWFKGCQSRAVPT
EPFKKRSCNTVSLNSQQLVTTPRLNIAIHIIGSRGDVQPFIPVAEALSRPPYSHRVRICT
HPIFKHFIESQGIEFFSIGGDPEALMAYMVKNPGLLPSRKSVKAGEIKKRRKEMWEILIG
AWRSCIEAGDGMGDRVMAANVRETKDLFIADAIIANPPSMAHIHCAEKLGIPLHMVFTMP
WSPTERFSHPLASMTYRGSTDAAVANYLSYIVMELLTWQGLGDLINRFRTRILCLDSISP
LWGYQLLTRLRVPYSYLWSQSLIPKPSDWGSHINITGFSFLSLANHYMPPPDLVGFLEKG
PPPIYIGFGSIVIDDPPALTQLIFDAVKLAGVRAIISRGWGGIGRGDIPETIYLIGDCPH
DWLFQRVSAVVHHGGAGTTAAGIAAGRPTVIVPFFGDQPFWGQMIAQAGAGPKPIPFKEL
TAEILASSIIFSLKTEVQEAVQKMAERIGAEDGARGTAVDFQERLDIDHLRCDICPDRLA
VWRHKTTGIHLSGFAAACLVDKEHPIVGAVAAASNFVINLGTAASDFSQRLKNRPRWSSR
DNKAILPQMSWYNTNRDVHQPTITVNHNEDHDVSSTAREAHQGPPPNTNGNGMTIAELTN
PTHNGILKDSIRLAPTEIENFAHKMATKSLLTGEIPTPETKRVPTLHERRKATWKAQEQG
PRGHMFYIMHITGRFAADVTKAGLKVPVALVYNVANGFHNYPSYTSNAVEVRQRNEITGL
GSGACTAGREFVLGLWDAFSGVVIKPYQGAKAEAGKGFGKGMWNGTLGFVYNLGAAIFGL
LGYTLKGIEKEFSKHHLTSLKAEILLIRLRQGIDDFSQATPEGKEMVVERWRCLQSQ

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	205	518	2.7e-54	0.743455497382199

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	7.69e-62	84	525	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	3.29e-30	86	518	4	392	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	3.21e-17	86	244	1	135	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
273616	MGT	1.68e-04	358	518	222	383	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK91708.1|GT1	0.0	1	894	1	883
AAD00894.3|GT1	0.0	4	896	2	910
QKD55584.1|GT1	0.0	1	894	1	889
QGI82773.1|GT1	0.0	1	894	1	889
QGI65525.1|GT1	0.0	1	894	1	889

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	1.11e-68	91	515	27	429	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	1.82e-68	91	515	47	449	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
3H4I_A	1.72e-30	84	489	1	350	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1IIR_A	1.32e-28	84	514	1	387	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
1RRV_A	3.25e-23	84	518	1	392	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	1.13e-131	61	525	132	574	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	7.23e-124	64	525	173	610	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q54IL5|UGT52_DICDI	6.04e-76	72	524	1152	1607	UDP-sugar-dependent glycosyltransferase 52 OS=Dictyostelium discoideum OX=44689 GN=ugt52 PE=2 SV=1
sp|A0A2Z4HPY4|EFUA_HORCR	4.85e-74	65	563	678	1166	Enfumafungin synthase efuA OS=Hormonema carpetanum OX=284138 GN=efuA PE=3 SV=1
sp|Q9Y751|ATG26_KOMPG	9.90e-74	74	513	751	1166	Sterol 3-beta-glucosyltransferase OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=ATG26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999700	0.000325

TMHMM  Annotations     

Start	End
823	845