CAZyme Information: FOMG_17566-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOMG_17566-t38_1-p1
• CAZy Family: GT31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
841	KI980356.1|CGC1	93229.51	5.3451

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum26406	20033	1089452	372	19661

• Gene Location: location=KI980356.1:18145-20670(-)

Full Sequence      

MENRKADDILQQLTLEEKISLCGAADWWRTHSVKRNGEILLPHIKASDGPNGSRGESFVS
GVKAASFPSASNLAASFNTEIAYKVGAGVAREAKTKNSDVLLAPTVCLVRSPLGGRNHET
YGEDPLILGLMGAAYVNGCQSEGIAATPKHFVANEIETRRRFVSVQIEERPLREIYLRPF
QLIMKNADPWAWMTSYNRINGVYCSENPRLLQTVLRDEWGFNGLVMSDWVGTYSTVEAIN
AGLDLEIPAPLYFRGEKLMQAVKDGKVSEETIDKRVRKLIELVLKTRRFEDPHDRTEYYE
DNKERDNFIADAATEGIILLRNENQVLPLKSGAKVAVIGQHAQIPPIMGGGSAVVPFEHV
VTPVDGLKAAGVDFTFEPGVPVYAALPLPTADVISKTGSGKAPLPVRLEWFNGSVIGENL
VKDEQILNPTFMIKEKWPDWLDQEYCARMTFDITPKTSGPHHFSVVSTGVSKLYVDGKEI
FHREQEPLMQREAFYFYRTKLEKTLSYSMNAGQTYTVSMGSWATPQDVIKKSHQKSQGGE
VVQGHAIGFMEYIDVQGRIREAAATAAASDVAVVFTGTTLEFESEGFDRETMDLQPAEYE
LVEAVLAANPNTVVVNTSGSPVTLTQFADKVAGLVQVFYPGQESGTAIARILTGQWNPSG
HLPVSWPRRLEDNPSHGNWPGENDIVHYEEGVYVGYRHYEKKQIKPLFVFGFGLSYTSFE
FSNLEVSGSLTRDTSIVANVIVRNVGPCKGKAVVQFYVGRAGDSKYDRPVKELRAFEKPE
IEAGNSTKVTVSLDKYAVSLYDTDKWVAEKGNYQVLVGLSSDDIRIVADFEVKEDFTWTG
V

Enzyme Prediction     

No EC number prediction in FOMG_17566-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	41	247	1.3e-63	0.9537037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.02e-70	67	825	120	758	beta-glucosidase BglX.
224389	BglX	6.02e-68	42	378	61	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	9.66e-47	317	696	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	1.44e-46	4	818	51	769	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	2.57e-40	67	282	88	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD60297.1|GH3	4.24e-287	8	841	9	834
CCT75026.1|GH3	2.02e-284	7	841	5	831
QGJ01306.1|GH3	1.15e-283	7	841	5	831
QGI87776.1|GH3	1.15e-283	7	841	5	831
QGI70417.1|GH3	4.64e-283	7	841	5	831

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	6.52e-163	1	841	1	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.03e-157	7	841	7	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	9.70e-128	9	837	8	679	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	7.79e-113	10	828	9	659	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.32e-106	5	835	3	716	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	1.93e-178	7	824	12	830	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|A1CA51|BGLI_ASPCL	4.31e-168	10	841	10	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q0CAF5|BGLI_ASPTN	1.07e-165	1	841	1	839	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	8.13e-165	10	841	10	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	8.13e-165	10	841	10	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999913	0.000130

TMHMM  Annotations     

There is no transmembrane helices in FOMG_17566-t38_1-p1.