CAZyme Information: FOMG_17275-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOMG_17275-t38_1-p1
• CAZy Family: GT2|GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
429	JH659370.1|CGC1	44788.07	7.2707

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum26406	20033	1089452	372	19661

• Gene Location: location=JH659370.1:30100-31744(-)

Full Sequence      

MASLLSTAWVIAQVATVSGLAFNVPSSPPSNSSAQLADAPVGVSFEFFAFPGYWNDVPST
STCLQNLKDLSGTWPPIRIGGTTQDRATYDASSSQQVTYTVANAGDAPSTLTFGPSFMSL
AGTYDGKVTIGFNRRLNNLANTVAAAAKACGNLSASNLISAGVFFGTSPMSIAGLTAAEG
QANSYVRQYCSHNYPQSKSTANLATLMSHSAIASQIKPFANEVAAAAGKNKPHVFGETNS
ATQGGGGISPTYGAGLWLLDYVMQSLIMGTETLYFHHGTIGNCQYCWWGRYSMGSPYFGA
YFATMALAGADRIAPLDDQTTGYAAYAIFKDDKPIRVLLYNSDYYTSGSRPSQSFTLSGL
SGSTVLAKRLTAAASTSRVDAGQSPTVAGQTFENGSCKIQGQSTVESATVSGGKATFTLQ
ASEALLVLL

Enzyme Prediction     

EC	3.2.1.31:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH79	157	360	3.6e-31	0.45714285714285713

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407104	Glyco_hydro_79C	1.88e-26	325	426	1	103	Glycosyl hydrolase family 79 C-terminal beta domain. This domain is found at the C-terminus of glycosyl hydrolase family 79 proteins. It's function is not yet known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD62931.1|GH79	4.90e-292	1	429	1	476
BCB92231.1|GH79|3.2.1.31	1.36e-282	1	429	1	476
QGI88456.1|GH79	6.45e-281	1	429	1	476
CCT75870.1|GH79	6.45e-281	1	429	1	476
QGI71119.1|GH79	6.45e-281	1	429	1	476

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7DFQ_A	1.68e-271	20	429	3	459	Chain A, 4-O-alpha-L-rhamnosyl-beta-D-glucuronidase [Fusarium oxysporum],7DFS_A Chain A, 4-O-alpha-L-rhamnosyl-beta-D-glucuronidase [Fusarium oxysporum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7SFB0|GUS79_NEUCR	2.28e-17	17	347	17	441	Beta-glucuronidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU00937 PE=1 SV=1
sp|A2QEQ6|GUS79_ASPNC	1.66e-14	18	356	31	461	Beta-glucuronidase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=An02g11890 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001122	0.998857	CS pos: 19-20. Pr: 0.9550

TMHMM  Annotations     

There is no transmembrane helices in FOMG_17275-t38_1-p1.