CAZyme Information: FOMG_17084-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOMG_17084-t38_1-p1
• CAZy Family: GT22
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
480	JH659363.1|CGC1	51850.19	4.5899

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum26406	20033	1089452	372	19661

• Gene Location: location=JH659363.1:73238-74794(+)

Full Sequence      

MASILLLATITLLIVIASAQQCNFKTLKTSYPAPVTEDSWDYSIVANELRRPRGILFDSE
GALIVIDSGNGIIHFELDDEGGTCLQVRKKTTLLKKDNLNHGIALSKDGRTLYASTSDEV
FAWPYDPSKVILRKSSVQTLVSNMTNGGHTSRTLLISQKHPDMLLVSRGSDGNDDAGAED
RDSGRSQIRAFNISSFSSNSDRKPYDYLDGVIIGWGLRNSVGVAEHPETGGIFSVENSAD
NLHRDGKDIHEDNPGEEMNFHGYLNGSDDQGGNYGYPLCYTLWSTNDFPNLGDLKIGDQF
PADRQADGDKATALTDAECKSDYIAPVLAFQAHTAPLDLKFNENGTRAYISFHGSWNRNP
PVGYKVSYVDFQNGRPASSSRSTNATTPIIYNKDLSKCPDDCFRPVGLAWDSNGRLWFSS
DKTGEVFVLSQESGSGSSGGNGSESGAGNDDDDNDSASLQPGSAAFIITLAALIIGGLLA

Enzyme Prediction     

No EC number prediction in FOMG_17084-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA12	27	429	8e-173	0.9875311720698254

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225044	YliI	2.70e-19	28	421	45	385	Glucose/arabinose dehydrogenase, beta-propeller fold [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD50391.1|AA12	0.0	1	480	1	480
QPC72375.1|AA12	1.52e-248	11	480	15	485
CEI41287.1|AA12	2.32e-248	11	480	15	487
QPC63491.1|AA12	6.18e-248	11	480	15	485
CEF82837.1|AA12	1.24e-247	11	480	15	485

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I1T_A	1.06e-152	22	431	1	404	Calcium structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6I1Q_A	1.61e-151	25	431	2	402	Iodide structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6H7T_A	1.67e-151	25	431	3	403	Native structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6JT5_A	3.44e-74	45	431	26	410	Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_A Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_B Chain B, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q44091|SNDH_GLULI	3.12e-14	97	421	158	433	L-sorbosone dehydrogenase OS=Gluconacetobacter liquefaciens OX=89584 PE=4 SV=1
sp|O51055|Y024_BORBU	1.24e-09	47	427	47	372	Uncharacterized protein BB_0024 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0024 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000234	0.999720	CS pos: 19-20. Pr: 0.9798

TMHMM  Annotations     

There is no transmembrane helices in FOMG_17084-t38_1-p1.