CAZyme Information: FOMG_16406-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOMG_16406-t38_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
674		75473.57	8.9863

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum26406	20033	1089452	372	19661

• Gene Location: location=JH659352.1:259375-261399(+)

Full Sequence      

MVSYHESNPLWSYPFSFNVTPSRMLTTSPVSVPSPALTSASRSAPAPSPTPQSVSIQGSP
PHSPMPSTSPAQQLQAPLNVRHSGSHSAFSFLSTSSRPASTMGDDGTSRPSASSSVQTLG
SVRSYRSTSSNSPLYMFKNPMKASKPLPFEEAELSEEDFEVYTRLAKEQQVHEAPATWSK
WITRFLYALFLASLVYFVFVGFPLWDGVALLFWRFFHSAEHQNQIWGLIAFAVAGTLRNV
LPQFFCTFDRKEPGQDNEKARDASECCIVIPCYKAAETLRATIPACLQVFSPEQVFVVAN
GNSPTPLDHTADVCAEFGVNHTWVPVGSKITAEFVGVALASKYKYCMLIDDDVILPANLP
LPTQLFGDHAKDKVACVGYTIKSVGANSSRGTLIQQVQDIEYKVAGLAKVFQTYYGSVIF
PHGAIALWRRDVLEKVFHAHPGYHISEDWFLGHTARAAGYHMVMSSQVFVETETPPRLFP
SLFPSKGGSRGGYGEMSIYKQRFFRWNFFFIFRIWSNLAYLTFSWRLGWRELVTKLWVFG
EIYDSLIFLSAPLVMPTALAASWRLTLIVTGGLLAFNFLLVLWFNAIHLGLLRRGRPNDE
RVAWLAFPVYMWVKFILLFVNIASVYWAIYEYAFFFTRQHLRVTENVTAWKVIRQTQNAR
PATATALASSLVSS

Enzyme Prediction     

No EC number prediction in FOMG_16406-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	266	477	3.7e-23	0.9217391304347826

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404520	Glyco_tranf_2_3	4.61e-24	268	479	6	218	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
224136	BcsA	3.99e-19	224	652	10	430	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	1.69e-18	268	436	1	169	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
132997	Glyco_tranf_GTA_type	5.65e-09	268	378	1	112	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
404513	Glyco_trans_2_3	3.13e-08	347	478	3	128	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI64086.1|GT2	4.12e-242	125	655	99	630
QRD00921.1|GT2	2.39e-163	111	649	86	612
CAK44102.1|GT2	9.46e-127	159	653	170	655
BCR93365.1|GT2	7.77e-126	159	653	170	655
BCS06011.1|GT2	7.77e-126	159	653	170	655

PDB Hits     

FOMG_16406-t38_1-p1 has no PDB hit.

Swiss-Prot Hits     

FOMG_16406-t38_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000000

TMHMM  Annotations     

Start	End
187	209
224	241
506	528
538	560
565	587
607	629