CAZyme Information: FOMG_16337-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOMG_16337-t38_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
659		72392.84	5.8765

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum26406	20033	1089452	372	19661

• Gene Location: location=JH659352.1:61925-63904(-)

Full Sequence      

MSDSSTIHVPEATVGSVSERGEAIPEEELDTLDGYEYVVVGSGAGGGPLAANLARNNHRV
LLLEAGDDQGSNFNQQVPAFHSKATEDEKMRWDYFVKHYADEEAAQKDSKMTWETPTGTL
YIGLNPPSGSKPKGILYPRAGTLGGCTAHNAMITIYPHENDWSNIAILTGDDSWHPNNMR
QYFKRLERCEYLPNGTPGHGFTGWLGTDRADLRLALGDFKILSIISAAATAMGNTILGLI
PEKVSQLLGLLLRDMNSIDPRRDMTEGIYQIPLTMSHGKRSGVRDFLVETAKKYPLDIRT
GCLATRVIFDESSLANSTPKATGVEFLEGSSLYKADPRSSSSTNGTKRRVRISREVILAA
GAFGTPQLLKLSGVGPMDELQKFGIRVVKDMQGVGTNLQDRYEIPIITKIEDDFPIITKC
TFGEPEDPCLADWYRQRGPYLSNGLPIGIVKKSSQADADPDLFIFGGPAFFRGYYPGYSK
LTTSDKRHFTWAVLKAHTHNQDGTVMLTSSNPRDVPDINFNYFTTSQGEIEKSERDLGAI
AEGVAFARRIMDDVLPIVTGPLEEALPGRHLASTEQVKTFIRNEAWGHHASCSCPIGSDG
DPKAVLDSRFRVRGVSNLRVVDASVFPRIPGFFIVLPIYMVSEKAADVILEDIGERSHV

Enzyme Prediction     

No EC number prediction in FOMG_16337-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	35	652	2.6e-98	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	2.46e-69	49	657	22	541	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	5.56e-66	49	650	20	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	3.95e-34	502	645	4	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	8.24e-19	305	631	244	558	Protein HOTHEAD
366272	GMC_oxred_N	3.74e-18	135	403	19	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD53806.1|AA3	0.0	1	659	1	659
UQC85673.1|AA3	1.75e-243	7	650	5	660
CEI61512.1|AA3	3.04e-240	9	651	22	671
UPL01126.1|AA3	3.37e-237	5	651	18	671
QRD81945.1|AA3	1.36e-234	35	652	30	657

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YS2_AAA	1.56e-34	35	646	8	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YS1_AAA	2.10e-34	35	646	8	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6ZH7_A	2.10e-34	35	646	8	557	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YRU_AAA	2.10e-34	35	646	8	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
5NCC_A	2.42e-34	35	646	24	573	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8BJ64|CHDH_MOUSE	1.75e-46	33	649	41	573	Choline dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Chdh PE=1 SV=1
sp|Q6LGH5|BETA_PHOPR	2.16e-46	35	650	5	531	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1
sp|Q6UPE0|CHDH_RAT	3.41e-46	33	649	44	576	Choline dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Chdh PE=1 SV=1
sp|Q8NE62|CHDH_HUMAN	2.20e-43	23	649	29	571	Choline dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=CHDH PE=1 SV=2
sp|Q8D3K2|BETA_VIBVU	6.50e-43	35	650	5	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000031	0.000050

TMHMM  Annotations     

There is no transmembrane helices in FOMG_16337-t38_1-p1.