CAZyme Information: FOMG_16317-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOMG_16317-t38_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
549		59781.47	5.3134

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum26406	20033	1089452	372	19661

• Gene Location: location=JH659351.1:306646-308350(+)

Full Sequence      

MHELYMWSFADGIRAGADHAMCSYQLLNQTHACANSKALNGLLKGELGLQGSILSDWFAT
HSGVSSINAGLDLNMPGGWASPYFMNMSQYVENGDVSDERLDDMVRRILTPDFRYKQNSP
DYPALDLSLNEFKEQETAATGNTILLPATPEEIPMWNIGGTKNRDVRKDHGKFVRELGAA
GAVLLKNDADLSQGQFALNPIDPIGPEMGANAQGSGSGTGRFSYFVSPLQAIKERMGSDL
VQYILDNKAIASNIGSICPAPEACLVFVKSHIGEATDRETLGLDWDGNAIIDTVSQKCNN
TIVVTHTGGPNNMPWADNPNVTAIIAGHLPGQEIGHSIADILWGDLNPSGKLPYTIAHNE
SDYNASVVNLTGSTGIDAWQSDFTEGLYTDYRHFNESDIEPLYEFGFGLSYTTFSVKLGS
VTKLVRNASPMPLNRPTQPGGNPALFEPLVKVTITVRNTGKLAVATVPQLYLSLPDSAPR
GTPVKVLRGFDKTKKLSPNQSQKISFVLTRKDMSFWDVTKQDWLIPKGRFSIKVGFSSRD
LPVEGSVVF

Enzyme Prediction     

No EC number prediction in FOMG_16317-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	1	76	1.3e-19	0.37962962962962965

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396478	Glyco_hydro_3_C	6.59e-51	182	391	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
185053	PRK15098	6.62e-45	1	540	232	756	beta-glucosidase BglX.
405066	Fn3-like	6.46e-24	467	538	2	71	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.
178629	PLN03080	7.50e-19	1	544	242	778	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	1.03e-12	1	110	196	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEI70409.1|GH3	0.0	1	549	223	789
QKD58995.1|GH3	0.0	75	549	1	492
QDS71883.1|GH3	5.95e-175	1	547	233	801
AAM94393.3|GH3|3.2.1.-	1.25e-174	1	549	219	792
UDD55000.1|GH3	4.79e-174	1	547	249	810

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JU6_A	1.47e-104	1	544	222	848	Chain A, Beta-glucosidase [Rasamsonia emersonii],5JU6_B Chain B, Beta-glucosidase [Rasamsonia emersonii],5JU6_C Chain C, Beta-glucosidase [Rasamsonia emersonii],5JU6_D Chain D, Beta-glucosidase [Rasamsonia emersonii]
5NBS_A	8.76e-102	1	544	221	853	Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A],5NBS_B Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A]
5FJI_A	7.05e-101	1	544	207	837	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus],5FJI_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus]
3ZYZ_A	2.37e-99	1	547	181	710	Chain A, Beta-d-glucoside Glucohydrolase [Trichoderma reesei],3ZZ1_A Chain A, BETA-D-GLUCOSIDE GLUCOHYDROLASE [Trichoderma reesei]
4I8D_A	2.43e-99	1	547	182	711	Chain A, Beta-D-glucoside glucohydrolase [Trichoderma reesei],4I8D_B Chain B, Beta-D-glucoside glucohydrolase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8NMR5|BGLG_ASPFN	4.80e-174	1	547	249	810	Probable beta-glucosidase G OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglG PE=3 SV=1
sp|Q2U325|BGLG_ASPOR	4.80e-174	1	547	249	810	Probable beta-glucosidase G OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglG PE=3 SV=1
sp|Q0CUC1|BGLG_ASPTN	5.73e-173	1	546	249	816	Probable beta-glucosidase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglG PE=3 SV=1
sp|A1DC16|BGLG_NEOFI	3.25e-169	1	541	249	804	Probable beta-glucosidase G OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglG PE=3 SV=1
sp|Q5B0F4|BGLG_EMENI	9.68e-163	1	541	250	808	Probable beta-glucosidase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglG PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999446	0.000604

TMHMM  Annotations     

There is no transmembrane helices in FOMG_16317-t38_1-p1.