CAZyme Information: FOMG_16039-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOMG_16039-t38_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
462	JH659349.1|CGC1	52843.26	6.0862

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum26406	20033	1089452	372	19661

• Gene Location: location=JH659349.1:250983-252371(+)

Full Sequence      

MANPISSLQGGILNNVAKLKTARTARVSSWDHSGLNEDAWVIQPGETAVLADLEGPGTIT
HLWFVQTCRRIVGPGLIPYSKSGVAMMEVHNALGLNYEVSDPDYYRKVIIKMYWDDSETP
NVLAPIGDFFCLGHSMAANFQSLPFTVSVKPSEEKKFGGAAAFNCYLPMPFNKRARIEIE
NQNDEAYFQYFYIDYELFPEPLSKDTLFFHSHWRRENPTNGWAPESIQTNSLETQVPNLD
GKGNYVILETEGAGQYIGCNHSVAHFQGTWWGEGDDMIFIDDDTWPPSMHGTGGEDYFTQ
GWGMQKNAYPFCGTIIHEEDVPNHQVSYRWHLADPVRFSKKIRVTMESGHANHLRDDWST
TAYWYQTLPGPKLSIQPVEERIPRKPDFPAGKRPEPPNTESLDPKRKAMIQQHQDRMEAF
VQDRNQWLERRAKATQERSKKNIEHAKDIRTRFYESVKGDNM

Enzyme Prediction     

No EC number prediction in FOMG_16039-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH172	105	366	3.3e-79	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402651	DUF2961	6.85e-113	106	366	1	234	Protein of unknown function (DUF2961). This family of proteins has no known function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD59092.1|GH172	0.0	1	462	1	462
UPK94269.1|GH172	0.0	6	460	5	459
CAP93243.1|GH172	2.45e-289	12	457	7	452
CAK39208.1|GH172	2.00e-285	12	457	7	452
QKX59927.1|GH172	9.65e-280	3	459	2	457

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7V1V_A	3.98e-164	11	453	6	446	Chain A, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_B Chain B, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_C Chain C, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_D Chain D, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_E Chain E, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_F Chain F, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_A Chain A, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_B Chain B, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_C Chain C, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_D Chain D, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_E Chain E, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_F Chain F, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1X_A Chain A, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_B Chain B, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_C Chain C, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_D Chain D, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_E Chain E, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_F Chain F, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium]
4KQ7_A	2.65e-52	15	366	11	327	Crystal structure of a DUF2961 family protein (BACUNI_00161) from Bacteroides uniformis ATCC 8492 at 1.62 A resolution [Bacteroides uniformis ATCC 8492],4KQ7_B Crystal structure of a DUF2961 family protein (BACUNI_00161) from Bacteroides uniformis ATCC 8492 at 1.62 A resolution [Bacteroides uniformis ATCC 8492]

Swiss-Prot Hits     

FOMG_16039-t38_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000047	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOMG_16039-t38_1-p1.