CAZyme Information: FOMG_15525-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOMG_15525-t38_1-p1
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381	JH659346.1|CGC2	44051.56	4.9624

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum26406	20033	1089452	372	19661

• Gene Location: location=JH659346.1:282215-283408(+)

Full Sequence      

MKFQTLLTVASANLVLANDLLAKTADSWIRNNQETQRAYWYGRAVVYEGIEATVELTKNK
TLLAWYRDQMDDVVSPNGTIINYDLTKYSLDNYRIGMNLLYWYKQTGEEKYKVAADFIRD
RINQHPRTPTGGFWHRSPTYPDQMWLDGIFMCDSFYAEWTAEFDAKNTTAWDDIVLQWDK
IQEVTIDKETGLPVHGFDESKTAVWADPETGASPIVWSRAVGWYIWSLIEVLDVFPKSHP
GYKRLVTYYKDLSSALLRAQGHESHLWELVMNKEYEGVEGNYVESSASAMFTYGWLAGLR
RGLLDEKTYTKPAKQAYKRLIRDFVTNNNNGTITWEGTVEVGSLNSDASFEYYTEVPVVP
NDTRGMGPFMMAIYEWERRSK

Enzyme Prediction     

No EC number prediction in FOMG_15525-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	32	378	2.3e-100	0.9819277108433735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	2.14e-65	17	378	12	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	3.31e-61	41	379	29	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD55506.1|GH105	3.93e-294	1	381	1	381
CCT69602.1|GH105	5.76e-287	1	381	1	381
QGI65428.1|GH105	5.76e-287	1	381	1	381
QGI96309.1|GH105	5.76e-287	1	381	1	381
QGI82677.1|GH105	4.73e-286	1	381	1	381

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.86e-78	25	377	9	359	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	2.38e-48	41	377	41	365	Structure of Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.02e-47	41	377	31	355	Chain A, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4Q88_A	3.20e-06	105	320	105	307	Chain A, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34559|URHG2_BACSU	1.23e-47	41	377	41	365	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	8.95e-28	191	375	38	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	8.95e-28	191	375	38	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.157530	0.842470	CS pos: 17-18. Pr: 0.7858

TMHMM  Annotations     

There is no transmembrane helices in FOMG_15525-t38_1-p1.