CAZyme Information: FOMG_15065-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOMG_15065-t38_1-p1
• CAZy Family: GH93
• CAZyme Description: lysozyme

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
258	JH659344.1|CGC3	27955.91	9.1503

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum26406	20033	1089452	372	19661

• Gene Location: location=JH659344.1:354418-355302(+)

Full Sequence      

MKIHIFAVHFLAVASSAAFLITDEGVRCRSGPTTSNAIQRQFAKGTDVAITCQTEGTHIK
GNALWDKTTFGCYVSDCYVATGSSGYVTSKCRSCKAPKSNAATVNLIASFKGFRPDVYND
PTGNPTVGYGHLCDAPQCSEAKYPIPLSIVNGKKLLADGMKEFEICITAMLNSKANLNRN
QYGALISWAFNMGCGNADSSTLVGRLNNGEDPNTVISQELPQWVNVSGQRLPGLVRRRNA
EIELAQKPTRRRALPKRC

Enzyme Prediction     

No EC number prediction in FOMG_15065-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	101	241	1.1e-31	0.9781021897810219

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
381599	lyz_endolysin_autolysin	2.02e-44	104	244	2	134	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
381620	lyz_P1	4.42e-29	100	244	3	138	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
226295	RrrD	3.70e-24	104	248	12	150	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
381619	endolysin_R21-like	4.95e-21	101	244	6	140	endolysin R21-like proteins. Unlike T4 E phage lysozyme, the endolysin R21 from Enterobacteria phage P21 has an N-terminal SAR (signal-arrest-release) domain that anchors the endolysin to the membrane in an inactive form, which act to prevent premature lysis of the infected bacterium. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
411609	sporang_Gsm	3.24e-12	29	128	4	101	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGJ01409.1|GH24	4.93e-167	1	258	1	258
QGI70519.1|GH24	4.93e-167	1	258	1	258
CCT75183.1|GH24	2.01e-166	1	258	1	258
QGI87874.1|GH24	4.05e-166	1	258	1	258
AEO71812.1|GH24	1.35e-109	12	258	12	261

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ET6_A	9.60e-11	104	244	57	192	Chain A, Lysozyme [Acinetobacter baumannii]
6H9D_A	1.19e-07	98	248	5	149	Chain A, Lysozyme [Asticcacaulis excentricus],6H9D_B Chain B, Lysozyme [Asticcacaulis excentricus],6H9D_C Chain C, Lysozyme [Asticcacaulis excentricus]
7M5I_A	9.23e-07	104	244	14	152	Chain A, Endolysin [Escherichia coli O157 typing phage 15],7M5I_B Chain B, Endolysin [Escherichia coli O157 typing phage 15]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q37896|ENLYS_BPB03	2.61e-11	102	244	6	141	Endolysin OS=Bacillus phage B103 OX=10778 GN=15 PE=3 SV=1
sp|P07540|ENLYS_BPPZA	1.89e-09	102	244	6	141	Endolysin OS=Bacillus phage PZA OX=10757 GN=15 PE=3 SV=1
sp|P11187|ENLYS_BPPH2	2.57e-09	102	244	6	141	Endolysin OS=Bacillus phage phi29 OX=10756 GN=15 PE=1 SV=1
sp|P62692|ENLYS_BPLC2	9.85e-06	104	248	8	139	Endolysin OS=Lactococcus phage c2 OX=31537 GN=L3 PE=3 SV=1
sp|P62693|ENLYS_BPPHV	9.85e-06	104	248	8	139	Endolysin OS=Lactococcus phage phivML3 OX=10746 GN=L3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000258	0.999707	CS pos: 18-19. Pr: 0.6579

TMHMM  Annotations     

There is no transmembrane helices in FOMG_15065-t38_1-p1.