CAZyme Information: FOMG_14981-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOMG_14981-t38_1-p1
• CAZy Family: GH79
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358	JH659344.1|CGC2	41592.81	6.9655

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum26406	20033	1089452	372	19661

• Gene Location: location=JH659344.1:152656-153732(-)

Full Sequence      

MALQNIIQHLRARFGKYEQLYDEEHFESESPSYKRCVHKRFGFPRFRKLTVYLILINLII
LGLLIHSIRPLITLLVRNDELFAINFSVDHAAHPEAFQRPDGRKIPRILHQTAPNSSIPE
IWATSQQSCKEAYSDFEYKLWTDDGAREFLKEEFPWYLDTWDNYPFPIQRADAIRYFVLY
HFGGIYMDMDTYCNSSFPVDQIESLPGNDHALFKSTLPTGITNDFLISTARHPAFASAVS
RLASFHQTTRLWARLQPYAAIMLSTGPLFLTLAVQQYLLGQPILPSPTIHIMDPEMLLPY
MTDFETATWHQSDAQVLKWLGDRPWTWFSMGFIGVIAGVYTFNCVLSRTFTTLYRKLL

Enzyme Prediction     

No EC number prediction in FOMG_14981-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	122	197	1.3e-23	0.8888888888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	6.65e-46	96	350	73	314	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	7.48e-22	119	199	1	85	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD62321.1|GT32	5.36e-269	1	358	1	358
CCT75307.1|GT32	1.17e-247	1	358	1	358
QGJ01497.1|GT32	8.45e-245	1	354	1	354
QGI70607.1|GT32	8.45e-245	1	354	1	354
QGI87952.1|GT32	3.56e-238	1	354	1	349

PDB Hits     

FOMG_14981-t38_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33300|SUR1_YEAST	2.59e-55	47	356	2	302	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	2.61e-48	53	342	8	295	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	3.32e-43	105	319	82	291	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|Q10323|IMT3_SCHPO	1.23e-41	81	340	29	285	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	1.72e-37	104	320	63	272	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999925	0.000083

TMHMM  Annotations     

Start	End
49	68
257	279
325	347