CAZyme Information: FOMG_14416-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOMG_14416-t38_1-p1
• CAZy Family: GH67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
479	KI980351.1|CGC2	52373.80	4.7538

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum26406	20033	1089452	372	19661

• Gene Location: location=KI980351.1:314575-316112(-)

Full Sequence      

MIKAFASAPIPKVAVTLSIFSTLVSYFRRNTMGVFQKGAGLVLFLAQFVPVQSMKLDSKD
GILDASKGLAGDLISFYKGNETGQTPGLLPERTMGTDGYYWYQSGAFMGSFVDYWQLTGD
KTYNKLVTEGIQWQVGKGKDFMPANNTASMGNDDQSIWAFAALTAAEYGYPEPSEGQPEW
LDLAVAVWEEQRARWDTEVAQKTCNGGLRWQIMMTNAGFDYKSTLANVLFFNLGARLARL
TSNETYADYASKTWDWLETSELIDKETWAVYDGAQATEATKNCSNVNQIQWSANSAGLTM
GAAFMYNFTEGSDEWRKRTENLASATLETFFKKNGDFNEIACANSKGKCPRDIVMYKGFT
HRWLAVATQVAPFTASSILPVLRKSAEGLKAEGNGGDALEQKFSNFVVVSNLLIDDSSAP
GHQNETGKTDKAEDSPSSTSTPVSKSSSAEAEGNSAIKLTGSSSFLALSVLIMASQWIL

Enzyme Prediction     

No EC number prediction in FOMG_14416-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	62	404	7.4e-77	0.8715083798882681

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	6.74e-132	62	388	2	312	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD60681.1|GH76	0.0	32	479	1	448
CCT74640.1|GH76	3.45e-302	32	479	1	445
QGI87419.1|GH76	4.02e-301	32	479	1	445
QGI70057.1|GH76	5.71e-301	32	479	1	445
QGJ00947.1|GH76	5.71e-301	32	479	1	445

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	3.12e-116	52	387	26	354	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36091|DCW1_YEAST	3.88e-76	42	396	12	350	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|O74556|YCZ2_SCHPO	3.79e-74	41	396	9	347	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q6FLP9|DCW1_CANGA	2.71e-71	45	396	10	347	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q05031|DFG5_YEAST	3.70e-71	44	433	17	411	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DFG5 PE=1 SV=1
sp|Q75DG6|DCW1_ASHGO	2.37e-70	39	396	9	352	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999988	0.000009

TMHMM  Annotations     

There is no transmembrane helices in FOMG_14416-t38_1-p1.