CAZyme Information: FOMG_14324-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOMG_14324-t38_1-p1
• CAZy Family: GH55
• CAZyme Description: beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1021	KI980351.1|CGC2	113520.64	6.7453

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum26406	20033	1089452	372	19661

• Gene Location: location=KI980351.1:117243-120661(-)

Full Sequence      

MKLLSLSTVGLLALAGLSIGQETKDVPIQDNGLTNIVEWDDHSYLINGERIFVFSGEFHY
WRLPVPELWRDLLEKIKAAGFTAFSIYNSWGYHEATPGVLDFENGAHDFVSIMTLAKELG
LYLLIRPGPYVNAEANAGGFPLWVTTGEYGKLRNDDPRYTKAWSKYWTEISKIIEPHLIT
NGGNVAMFQIENELGGQWKNDDKRILNEPTANYMQLLKESARKAGIDVPVFHNAPNTRTF
SWSNDFERNATGNVDVTGVDSYPSCWSCNLDECTGTNGEYVPYNIQDYVTYFNKQSPRQP
HFLPEFQGGSYNPWGGPEGGCPGDIGPDFANIFYRDLLAQQATAISLYMMYGGTNWGWFA
CPVVATSYDYSSPISENRAIWDKYYETKSLTLFTRVAHDLTKTTRVTNSTSLSTNDAILI
SELRHEENDAAFYVARHDHSPSGTKETFKLHVKTSEGKLTIPQNEGSITINGHQSKVIPT
DFHFGKKTLLYSTAEVLTYSIIDNKEVIVLWLPEGEQGEFTLKGNTELKHDKSLKGIKVK
ASKKSVTVNYTQQKGLFTLNLKDGSTIVLADRKTAYKFWAPTLDNNPFAPVNKTVLIHGP
YLVRHATIKNGQLNIQGDLDSATETTVFAPESLKSIAWNGEKVKVSSKEGHKYTIKLKGP
SKVTLPKLESWKYADSLPEIKTDYKTSSSAWVVADKKNTTNAVLVPDLKNPVLYVDEYKI
HYGNHIYRATFPTTSSAPTGVYLNLTGGMAFGYSVWLNSDYIGSYLGEATTGHAGQEFSF
KNATLSKKENVLVVLMDNSGHDLRDGALDPRGITNATLIGPAKGGYKFSEWKIAGHAGSV
EGEVIDPIRGPLNEGGLYAERIGAHLPGFSDKKWKSYSSKQGTLVNPSAGVRAYRTTVDL
DIPDGLDVGVSFKLTAPSNTTFSATKKGYSNQVRVLLFVNGYQYGRFNPYIGNQISFPVP
PGVLNYDGENTIAVTVWSQSAQGGEVKVEWEVDYAHTSSFDVKFDSKYLRPDWTKERLQY
A

Enzyme Prediction     

EC	3.2.1.-:1	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	45	390	1.3e-88	0.9837133550488599

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396048	Glyco_hydro_35	3.57e-96	43	390	1	314	Glycosyl hydrolases family 35.
402180	BetaGal_dom2	3.78e-72	400	577	1	180	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyzes the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C-terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N-terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, pfam01301, which is N-terminal to it, but itself has no metazoan members.
198097	BetaGal_dom2	1.24e-67	399	578	1	182	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyses the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, which is N-terminal to it, but itself has no metazoan members.
166698	PLN03059	2.01e-34	37	376	30	323	beta-galactosidase; Provisional
404274	BetaGal_dom4_5	1.69e-33	858	980	1	109	Beta-galactosidase jelly roll domain. This domain is found in beta galactosidase enzymes. It has a jelly roll fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT74713.1|GH35	0.0	1	1021	1	1021
QGI87488.1|GH35	0.0	1	1021	1	1021
QGI70124.1|GH35	0.0	1	1021	1	1021
QGJ01015.1|GH35	0.0	1	1021	1	1021
QKD60609.1|GH35	0.0	1	1021	1	1021

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TG7_A	4.95e-172	33	986	2	938	Native structure of beta-galactosidase from Penicillium sp. [Penicillium sp.],1XC6_A Native Structure Of Beta-Galactosidase from Penicillium sp. in complex with Galactose [Penicillium sp.]
5IFP_A	5.32e-168	1	987	1	975	Structure Of Beta-galactosidase From Aspergillus Niger [Aspergillus niger CBS 513.88]
5IFT_A	1.47e-167	1	987	1	975	STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 3-b-Galactopyranosyl glucose [Aspergillus niger CBS 513.88],5IHR_A Structure Of E298q-beta-galactosidase From Aspergillus Niger In Complex With Allolactose [Aspergillus niger CBS 513.88],5JUV_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-b-Galactopyranosyl galactose [Aspergillus niger CBS 513.88],5MGC_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 4-Galactosyl-lactose [Aspergillus niger CBS 513.88],5MGD_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-Galactosyl-lactose [Aspergillus niger CBS 513.88]
4IUG_A	1.12e-163	1	986	1	972	Crystal structure of beta-galactosidase from Aspergillus oryzae in complex with galactose [Aspergillus oryzae]
3OG2_A	2.64e-154	20	986	7	970	Chain A, Beta-galactosidase [Trichoderma reesei],3OGR_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGS_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGV_A Chain A, Beta-galactosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A6RPN7|BGALB_BOTFB	0.0	27	1021	27	1007	Probable beta-galactosidase B OS=Botryotinia fuckeliana (strain B05.10) OX=332648 GN=lacB PE=3 SV=1
sp|B0XNY2|BGALB_ASPFC	0.0	21	1021	24	1015	Probable beta-galactosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=lacB PE=3 SV=1
sp|A7EBU5|BGALB_SCLS1	0.0	27	1021	27	1008	Probable beta-galactosidase B OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) OX=665079 GN=lacB PE=3 SV=1
sp|B2W791|BGALB_PYRTR	0.0	27	1021	36	1009	Probable beta-galactosidase B OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) OX=426418 GN=lacB PE=3 SV=1
sp|A2QA64|BGALB_ASPNC	0.0	4	1021	10	1017	Probable beta-galactosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=lacB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000258	0.999694	CS pos: 20-21. Pr: 0.9811

TMHMM  Annotations     

There is no transmembrane helices in FOMG_14324-t38_1-p1.