CAZyme Information: FOMG_13964-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOMG_13964-t38_1-p1
• CAZy Family: GH5
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
842		91672.27	5.0192

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum26406	20033	1089452	372	19661

• Gene Location: location=JH659342.1:80830-83573(-)

Full Sequence      

MSSSAEIDEILANLTLQEKISLLAGGSPWCTFPIPSKGVPVAKLSDGPNGARGKSIYDGP
TAACFPAACSIASSFDVDLAKRVATALAEETLTKGARCILSPTVCIQRHPLGGRNFETFS
EDPLLTGQMAIASVQGLQSKGVSATVKHLVANEQETDRLTVNTELSQRALREIYLKPFEM
VVKCANPWAIMTSYNKINGTHADSHEPLLKGILRGQWNWQGLVMSDWGGINSLADSLNAG
VDLEMPGPARWRTNEAVLDAVSRGEATEAIITERARNVLTFLNRLNCFQDPNWKEPEEKA
IDRPEHRALIREAGAKGIVLLKNTNDILPLTKEKVKGRKIAVFGYAKECLAHGGGSASVN
PHYRVTPWDALCEAFADADVEFVFAKGAHTFRQLPVLTTEVIGLDGSPGFSLKIFETGAS
EPMSTSHGFAKSELSLLDGHALEDKVVEIVGFLSLSKPGVYRVSLAGLGPTKLLVNGRIV
FHQVEPCLDAMAFLFGGSPVPEFELDLSKDMKYEIRIISAPLQSTDGKDLGFLKGQIGMR
LGFMSMTEYGKDLVSEAVELASSSDYSIVFTGNDPMWETEGQDQASFNLPKQGSQDRLVE
AVAAACPESTIVVNSTGVAVALPWLDQVAALLQAWFPGQEAGHSICDVLTGAQNSEGHLT
CTFMKQLEDCPAYGNFPGDLDDQQKREVNYSEGVFIGYRHFDRLPRDRINFPFGFGLSYT
KFDLALSNISQITEEKYLVHVRVSNMGKVEGAIAVQIYAGRKDSNPEDGPIQVLVGFKKV
RIEPQECASIDIPMYCRDLAYWDEKTGYWVLDGGEYVVHVSKSAGEPIVSSVVSLRQSTY
AP

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	35	246	4.6e-63	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	3.59e-68	34	365	55	379	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	3.94e-57	65	820	120	750	beta-glucosidase BglX.
395747	Glyco_hydro_3	5.36e-44	65	280	88	315	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	5.61e-44	318	698	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	7.39e-34	14	792	60	740	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD60163.1|GH3	0.0	25	842	26	843
UPK95485.1|GH3	0.0	3	842	2	816
CEF72767.1|GH3	0.0	3	842	2	834
CZS76034.1|GH3	0.0	3	842	2	834
UPK99435.1|GH3	0.0	3	840	2	832

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	2.30e-156	3	840	2	841	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	3.26e-152	3	840	2	841	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	3.87e-109	4	838	2	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.12e-104	13	835	11	663	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	3.64e-96	6	824	3	702	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	7.71e-296	5	842	9	845	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|Q0CAF5|BGLI_ASPTN	8.24e-169	6	831	5	827	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	1.13e-168	6	831	5	826	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	2.31e-168	6	840	5	835	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|Q5BB53|BGLI_EMENI	2.31e-168	6	840	5	835	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999939	0.000121

TMHMM  Annotations     

There is no transmembrane helices in FOMG_13964-t38_1-p1.