CAZyme Information: FOMG_13888-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOMG_13888-t38_1-p1
• CAZy Family: GH47
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
284		30233.40	3.9879

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum26406	20033	1089452	372	19661

• Gene Location: location=JH659341.1:761458-762459(+)

Full Sequence      

MGSLRFLLFASIATLVSCRDVPDNIKVFKESIIKQGSCNDTLAEGFHSADGDDGSYVYCG
DHLKDYNVIYLQGTKGKLVNMDIDCDGVQGSSADDGRCGSSGDTQSVTSFQDQLKSYGTD
QKDLDANIHPYVVFGNVGTKKNWPTFDAQKHGIKPLSVMAVVCGDKMFYGIWGDENGDDG
DEAMVGEASISLATACFGDDMNGDNGHDEDDVLYIAFPGSDAVPGEDGADWDAKNFKDFE
ESLGGVGDKLVARIEDTDSGASCLWPGTWGMGLLVASAMAAMVV

Enzyme Prediction     

EC	3.2.1.132:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH75	12	253	2.2e-81	0.9636363636363636

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399960	Glyco_hydro_75	9.90e-96	81	253	1	165	Fungal chitosanase of glycosyl hydrolase group 75. This family consists of several fungal chitosanase proteins. Chitin, xylan, 6-O-sulphated chitosan and O-carboxymethyl chitin are indigestible by chitosanase. EC:3.2.1.132. The mechanism is likely to be inverting, and the probable catalytic neutrophile base is Asp, with the probable catalytic proton donor being Glu. (see the Chitosanase web-page from CAZY).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD59625.1|GH75	5.80e-211	1	284	1	285
CCT73515.1|GH75	1.87e-209	1	284	1	284
QGI69134.1|GH75	1.31e-207	1	284	1	285
QGJ00023.1|GH75	1.31e-207	1	284	1	285
QGI86500.1|GH75	1.31e-207	1	284	1	285

PDB Hits     

FOMG_13888-t38_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WB37|CSN_ASPFU	1.28e-67	15	254	15	240	Endo-chitosanase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=csn PE=3 SV=1
sp|Q2U1H5|CSNB_ASPOR	9.15e-65	4	255	3	240	Endo-chitosanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csnB PE=3 SV=1
sp|Q2U3M5|CSN_ASPOR	4.15e-64	11	255	10	244	Endo-chitosanase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csn PE=3 SV=1
sp|Q9P961|CSN_ASPOZ	4.15e-64	11	255	10	244	Endo-chitosanase OS=Aspergillus oryzae OX=5062 GN=csn PE=1 SV=1
sp|Q875I9|CSN_ASPFM	4.88e-61	4	255	3	237	Endo-chitosanase OS=Neosartorya fumigata OX=746128 GN=csn PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000239	0.999739	CS pos: 18-19. Pr: 0.9779

TMHMM  Annotations     

There is no transmembrane helices in FOMG_13888-t38_1-p1.