CAZyme Information: FOMG_11938-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOMG_11938-t38_1-p1
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
456		47225.71	4.4722

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum26406	20033	1089452	372	19661

• Gene Location: location=JH659337.1:1292502-1293872(+)

Full Sequence      

MKVSATLAAGALALGVEAKNYLGFNSGATLANRAAKFKADFQAEFETAQNLKSAPGDFSA
VRLYTNIQAYSEDDPIEAFEAAIDTKTEILLGVWTSGTDNIDKEISALKKAVDKYGSKLT
DLVIGVSVGSEDLYRNSVTGVKNKGGVGVQPDVLVDFINDFKKAFKGTPIGKIPVGHVDT
WDVWGNATNKAVLDAIDFIGVDEYPYYENDKGNSIDNAAKLFNKAYEATIAASGGKPVWV
TETGWPYKGPDWDEAVPSVKNAQKYWRDVGCKYLFNKTPTFWYTLRDSNPDNKMKFAITD
NLSTTPLFDLSCDKVDDEETTSSAVHSKTKTESGASKPTHASNSTATFITSTASATSGSG
DDEEATGTATATGSGSKPTSGSGSGSESGSGSGSGSGSEGSGSSSGSGSESGSSSGSGSS
SESGSAPAETPSTITNGAASLGVSTVALAFLALFAL

Enzyme Prediction     

No EC number prediction in FOMG_11938-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	64	291	6.1e-17	0.8295819935691319

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	8.39e-26	22	271	46	267	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	7.56e-08	89	289	67	283	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD53268.1|GH17	2.90e-263	1	456	1	456
BAJ97248.1|GH17	2.63e-260	1	456	1	460
QGI91783.1|GH17	1.57e-240	1	456	1	450
CCT64555.1|GH17	1.57e-240	1	456	1	450
QGI78069.1|GH17	1.57e-240	1	456	1	450

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	9.30e-21	53	272	54	253	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	5.88e-20	53	272	54	253	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0C7P6|EGLC_ASPTN	2.27e-99	11	331	10	328	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=eglC PE=3 SV=1
sp|A2QH21|EGLC_ASPNC	1.47e-96	5	312	4	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=eglC PE=3 SV=2
sp|A1DJ47|EGLC_NEOFI	5.42e-94	7	327	6	325	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglC PE=3 SV=1
sp|Q4WG16|EGLC_ASPFU	6.80e-94	7	312	6	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglC PE=3 SV=1
sp|B0XXF8|EGLC_ASPFC	7.65e-94	7	312	6	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.270065	0.729908	CS pos: 18-19. Pr: 0.5661

TMHMM  Annotations     

There is no transmembrane helices in FOMG_11938-t38_1-p1.