CAZyme Information: FOMG_11464-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOMG_11464-t38_1-p1
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
437		48778.44	9.4724

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum26406	20033	1089452	372	19661

• Gene Location: location=JH659337.1:144107-145420(-)

Full Sequence      

MHLSSLFSTALLFSTAIAAPQPDYSVTNAAQHGKVAKYQKQCPFSIPHVKPHNQRYEHAL
NFPKGCESGKFINWKTFKANGVNLGAWLAKEKTHDPVWWSSLGTKAAATIDEWGLCQALG
KQCGPILEKRYESFLNTSTIDTLAKVGVNTLRITTTYAAWVKVPGSAFYHGKQQEHLRRI
TQYAIERYNMHIIIGLHSLPGGINNLDIGEAFGHDGWFYNSTNLAWSFKAVDKVLDFVKA
SGHKNAFTIAPLNEASDNLAGFGSAAGLSDKATNWILTYMNGVFQRVEAVDKRIPVMLQD
NFKGAAFWSPLFDKKRNLVIDSHVYYFAASGTYSQYVAPAVCGQAKYLAEETKFPVFVGE
WSLQTMYNNTLSVPNRKTIFDTQRYAWQKYIAGGAFWTAVSYSTTPVDGQGIQRDYWSYV
DLVRAGVITKATTKSYC

Enzyme Prediction     

No EC number prediction in FOMG_11464-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	131	410	2.2e-118	0.9964285714285714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.77e-04	68	424	7	383	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD53692.1|GH5_23	0.0	1	437	1	437
CCT64988.1|GH5_23	0.0	1	437	1	437
QGI92196.1|GH5_23	0.0	1	437	1	437
QGI78478.1|GH5_23	0.0	1	437	1	437
QGI61298.1|GH5_23	0.0	1	437	1	437

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6LA0_A	1.08e-112	67	428	7	364	Chain A, Glycoside hydrolase family 5 [Aspergillus oryzae],6LA0_B Chain B, Glycoside hydrolase family 5 [Aspergillus oryzae]
6I1A_A	3.15e-111	68	426	11	367	Crystal structure of rutinosidase from Aspergillus niger [Aspergillus niger],6I1A_B Crystal structure of rutinosidase from Aspergillus niger [Aspergillus niger]
6ZB9_A	1.88e-06	78	367	2	302	Chain A, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2RAR6|EXGA_ASPNC	1.76e-18	72	362	35	310	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000274	0.999685	CS pos: 18-19. Pr: 0.9796

TMHMM  Annotations     

There is no transmembrane helices in FOMG_11464-t38_1-p1.