CAZyme Information: FOMG_08944-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOMG_08944-t38_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1047		116486.94	6.2893

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum26406	20033	1089452	372	19661

• Gene Location: location=JH659334.1:332051-335470(-)

Full Sequence      

MIDMIDSGTSGRSVSISGAAANGPLGHVTGLSLGTSTPVPVVAIIGDKGSGKTSLFEALS
GLSLHGSRLSSTKFPIHAYFTNTSRAGTTLKARIKPGKVDGQNKELSEHLQSFEVNYEGD
LAAVNLPHIVRQATNHMQVATAFSDEKEQEEQQVSDNVLVIEIAGPDLFSMEIVDTPGLS
SSEWHCRACWLGWKLTSTGPTVDDAQELTRALILDLVKQPNTIILAVVDATNDMSSQEGP
WLARAADVTGNRTVAVVTKCDLVPLEERRFVLRAMRNKERHLGHPWFATRSLSCNERDQD
CTLETRNSIEGSLFSEKEWAVLKRRRRVGALALRDHLKTRVNVMLRGSIDLLTTLLNTPA
HSVAPTHTANTDKVQPTDVYATSQETVVADADLEFASDAPRPTPLLNAVIVALTVAICLC
LIALGCSTMAMEIASEGGWTRLFLLITAVPQIILSLFFCQAIVVTIFQMIGPVTQLKVNS
KFYSAKRTRRLDGTKVLLPHVTIQCPVYKEGLEGVIRPTVRSLSAAIRNYESFGGTASIF
INDDGMQLVSPEEADERRMFYKENNIGWVARPAHNANGEGISKFIRRGKFKKASNMNYAL
GISLKVEDKLVQIVRDEHWTQADESAAYQRCLDEVLSEELGRAWVGGDIRVGDYLLLVDS
DTRVPTDCLIDAVSELEASPRVAILQFTSGVMNVTTSYFESGITFFTNLIYTAIAYAVAN
GDVSPFVGHNAFIRWSALQEVGSQDDGIICNEKDPNATTPYEKFWSESHVSEDFDVSLRL
QTLGYHIRLATYCGDGFKEGVSLTVYDELARWQKYAYGCSELLFYPIKDWWRYGIFTPLF
KRFIMSNMPLGSKITIMSYIGTYYAIGYSWIGSLLNYFLIGWLNGELDHYYMSSWRVWVA
LVVVFSIAGNITLALIRYRSQQVSLLRELWTCFKWVALMFVFLGGISMHVCKAILCHMLS
IDIGWGATSKEVEDTNFFQEISIIIAGFKYVFIFCLAVTALMICGVYAFPYLWRINELVA
IFPLATIIFCHFFLPIALNPNLMKFTW

Enzyme Prediction     

No EC number prediction in FOMG_08944-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	654	879	6.6e-48	0.9695431472081218

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	4.28e-44	654	880	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
206738	DLP_1	1.25e-42	38	337	2	265	Dynamin_like protein family includes dynamins and Mx proteins. The dynamin family of large mechanochemical GTPases includes the classical dynamins and dynamin-like proteins (DLPs) that are found throughout the Eukarya. These proteins catalyze membrane fission during clathrin-mediated endocytosis. Dynamin consists of five domains; an N-terminal G domain that binds and hydrolyzes GTP, a middle domain (MD) involved in self-assembly and oligomerization, a pleckstrin homology (PH) domain responsible for interactions with the plasma membrane, GED, which is also involved in self-assembly, and a proline arginine rich domain (PRD) that interacts with SH3 domains on accessory proteins. To date, three vertebrate dynamin genes have been identified; dynamin 1, which is brain specific, mediates uptake of synaptic vesicles in presynaptic terminals; dynamin-2 is expressed ubiquitously and similarly participates in membrane fission; mutations in the MD, PH and GED domains of dynamin 2 have been linked to human diseases such as Charcot-Marie-Tooth peripheral neuropathy and rare forms of centronuclear myopathy. Dynamin 3 participates in megakaryocyte progenitor amplification, and is also involved in cytoplasmic enlargement and the formation of the demarcation membrane system. This family also includes interferon-induced Mx proteins that inhibit a wide range of viruses by blocking an early stage of the replication cycle. Dynamin oligomerizes into helical structures around the neck of budding vesicles in a GTP hydrolysis-dependent manner.
395279	Dynamin_N	5.16e-17	42	259	1	167	Dynamin family.
224136	BcsA	2.49e-15	442	973	1	427	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
197491	DYNc	1.88e-10	32	263	17	205	Dynamin, GTPase. Large GTPases that mediate vesicle trafficking. Dynamin participates in the endocytic uptake of receptors, associated ligands, and plasma membrane following an exocytic event.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI99503.1|GT0	0.0	16	1047	1	1034
QGI68613.1|GT0	0.0	16	1047	1	1034
CCT73007.1|GT0	0.0	16	1047	1	1016
QKD62182.1|GT0	0.0	137	1047	1	912
QGI85813.1|GT0	0.0	386	1047	5	642

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4P4S_A	1.01e-11	39	282	13	214	GMPPCP-bound stalkless-MxA [Homo sapiens]
4P4S_B	1.50e-11	39	282	28	229	GMPPCP-bound stalkless-MxA [Homo sapiens]
4P4T_A	1.67e-11	39	282	34	235	GDP-bound stalkless-MxA [Homo sapiens]
4P4U_A	1.70e-11	39	282	34	235	Nucleotide-free stalkless-MxA [Homo sapiens]
5GTM_A	3.74e-11	39	282	38	239	Modified human MxA, nucleotide-free form [Homo sapiens],5GTM_B Modified human MxA, nucleotide-free form [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5U752|MX_SOLSE	6.12e-13	39	316	33	268	Interferon-induced GTP-binding protein Mx OS=Solea senegalensis OX=28829 GN=mx PE=2 SV=1
sp|Q800G5|MXE_DANRE	2.44e-12	39	278	43	240	Interferon-induced GTP-binding protein MxE OS=Danio rerio OX=7955 GN=mxe PE=2 SV=1
sp|Q6TKS7|MX_CTEID	4.24e-12	39	278	43	243	Interferon-induced GTP-binding protein Mx OS=Ctenopharyngodon idella OX=7959 GN=mx PE=2 SV=1
sp|Q6PW23|MX_EPICO	7.34e-12	39	316	33	268	Interferon-induced GTP-binding protein Mx OS=Epinephelus coioides OX=94232 GN=mx PE=2 SV=1
sp|Q6DKF0|MXC_DANRE	7.34e-12	39	278	43	240	Interferon-induced GTP-binding protein MxC OS=Danio rerio OX=7955 GN=mxc PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000070	0.000000

TMHMM  Annotations     

Start	End
408	430
442	464
697	719
860	882
897	916
929	951
990	1012
1019	1038