CAZyme Information: FOMG_08823-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOMG_08823-t38_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
848	JH659333.1|CGC3	94187.34	5.6429

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum26406	20033	1089452	372	19661

• Gene Location: location=JH659333.1:3011247-3014028(-)

Full Sequence      

MPLLVDVDHALKELTIEEKVKLLSGKDNWSTYPIERLNIPSLVATDGPHGARGTSFFNGP
LGALLPSATAMGATFDTRLMRSVGNMLAAETMEKGCQILLAPTVCLQRSPLIGRGFEAFG
EDPILSGMLASEYINGVQEKGVATSIKHYAAHDQSYMSPEDDLQVAERTLREVHLLPFQL
AVKHANPWSFMTSYHRINGVHTSENEWLNTQILRREWGWDGLLMSDWGGVFSTTEAMNAG
LDLEMPGPSRWRGDLLHLALMSRKVTKSMINERVRNVVKLVNRVQPAIKHTTPNEEAGDT
PTKRALCREVAQGSIVLLKNERKVLPLDPSAQQTYGLIGPGVIYPAVSGGGSADLRPYYV
QKPLEAIQDVVGREKVRTAVGCYSHIFTPPLSEYVTVPGTDEEGYQLFWYGEDPETNPEA
EPLHSTTTTQATMYFADSHPSGVPDMYWLRVVTLYRATKTATMHIGLCVMGKGRLYIDGK
AAIDLWSSHPKKTLQTPMFNQASMELTADLEAHEGQVYEISVLLKNETMSSNIGGPYVGT
SCIGGVRIGCCEKIDPAVALAEAVEVARNVDVPILIAGLNADYETEAVDRHDLELPPGIN
ELVRRVIEANPKTIIVNQSGCPVTMPWVNNASTLVQAWFGGQETGNAIADVLFGRYNPSG
RLSITFPRRLEDTPSFLSFGKGVRHMYYGEGVFIGHRYYEKLRNDPLFYFGFGLSYTTFE
YSNLQLPEVVDLGDNGERTFNVSVDVMNTGDMDGHEIVQLYVSDIECATLRPCKELKGFA
KLWVPKGGKVKATISLDKYAVSYWDEEEKKWLAEKGTFKVVISRSADPKDEVLQRQFRLE
RDLYWRGV

Enzyme Prediction     

No EC number prediction in FOMG_08823-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	34	246	2.3e-63	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	3.27e-78	36	822	101	750	beta-glucosidase BglX.
224389	BglX	8.11e-66	36	372	57	388	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	4.22e-51	518	695	44	215	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	2.09e-42	14	810	60	757	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	5.50e-41	36	280	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD58970.1|GH3	0.0	1	848	1	848
CEI68123.1|GH3	0.0	1	848	1	872
UPK98381.1|GH3	0.0	4	848	4	848
UPK92226.1|GH3	0.0	7	848	7	845
UPK96510.1|GH3	0.0	4	848	3	823

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.07e-199	6	848	5	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	5.25e-194	6	848	5	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.14e-132	5	839	3	668	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.25e-107	10	826	8	652	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.63e-84	7	826	4	702	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CA51|BGLI_ASPCL	9.43e-222	6	848	5	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	4.79e-219	5	848	4	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	9.58e-219	5	848	4	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	9.58e-219	5	848	4	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	2.26e-214	5	848	4	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000033	0.000013

TMHMM  Annotations     

There is no transmembrane helices in FOMG_08823-t38_1-p1.