CAZyme Information: FOMG_06725-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOMG_06725-t38_1-p1
• CAZy Family: GH11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
448		48442.18	4.7639

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum26406	20033	1089452	372	19661

• Gene Location: location=JH659332.1:1724244-1725694(-)

Full Sequence      

MKTVAFLSALAAVASATPTLKEPPSKRASLPAVSVSGNAFWTGKDRFYLRGIDYQPGGAS
ANEDPLADPDVCKRDIKYFKELGVNVIRVYAVDNKADHDECMSALDAAGIYLVLDVNNPK
YSINRAKPGPSYNAAYIQSVFATVEMFAKYDNTLAFFSGNEVMNDEKDTDKSAPYVKAIT
RDMRNYIKARKLRQVPVGYSAADVASNRMQTAHYMNCGSEEVRSDFFAFNDYSWCNSDFK
TSGWDVKVKNFTNYGIPIFLSEYGCIENRPRKFEEIEPMMDSQMSSVYSGGLMYEYSLED
NDYGIVTIKNGKVTTEKEFDLFKSALSKYPMPTGTGGAAKASHGVACPTSESVWQVDPSY
LPEMPSEAEKYMKDGAGKGPGINGKGSHFDTDSGTATASVAMGSSTSTGSASASGDDDDD
SGAASLGFGALYVSAAATLFTLVGTLLL

Enzyme Prediction     

EC	2.4.1.-:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH72	28	328	1.7e-124	0.9871794871794872

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397351	Glyco_hydro_72	2.41e-157	24	328	3	313	Glucanosyltransferase. This is a family of glycosylphosphatidylinositol-anchored beta(1-3)glucanosyltransferases. The active site residues in the Aspergillus fumigatus example are the two glutamate residues at 160 and 261.
395098	Cellulase	0.002	76	281	30	254	Cellulase (glycosyl hydrolase family 5).
240224	SIS_TAL_PGI	0.003	62	126	37	94	SIS_TAL_PGI: Transaldolase (TAL)/ Phosphoglucose isomerase (PGI). This group represents the SIS (Sugar ISomerase) PGI domain, of a multifunctional protein (TAL-PGI ) having both TAL and PGI activities. TAL_PGI contains an N-terminal TAL domain and a C-terminal PGI domain. TAL catalyzes the reversible conversion of sedoheptulose-7-phosphate (S7P) and glyceraldehyde-3-phosphate (G3P), to fructose-6-phosphate (F6P) and erythrose-4-phosphate (E4P). PGI catalyzes the reversible isomerization of F6P to glucose-6-phosphate (G6P). It has been suggested for Gluconobacter oxydans TAL_PGI that this enzyme generates E4P and G6P directly from S7P and G3P. G. oxydans TAL_PGI contributes to increased xylitol production from D-arabitol. As xylitol is an alternative natural sweetner to sucrose, the microbial conversion of D-arabitol to xylitol is of interest to food and pharmaceutical industries.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD54436.1|GH72	7.91e-303	1	448	1	448
QGI95399.1|GH72	1.63e-295	1	448	1	448
QGI64514.1|GH72	1.63e-295	1	448	1	448
CCT68580.1|GH72	1.63e-295	1	448	1	448
QGI81774.1|GH72	1.63e-295	1	448	1	448

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W62_A	6.61e-70	31	369	34	389	Saccharomyces cerevisiae Gas2p in complex with laminaripentaose [Saccharomyces cerevisiae],2W63_A Saccharomyces Cerevisiae Gas2p In Complex With Laminaritriose And Laminaritetraose [Saccharomyces cerevisiae],5O9O_A Crystal structure of ScGas2 in complex with compound 7. [Saccharomyces cerevisiae S288C],5O9P_A Crystal structure of Gas2 in complex with compound 10 [Saccharomyces cerevisiae S288C],5O9Q_A Crystal structure of ScGas2 in complex with compound 6 [Saccharomyces cerevisiae S288C],5O9R_A Crystal structure of ScGas2 in complex with compound 9 [Saccharomyces cerevisiae S288C],5O9Y_A Crystal structure of ScGas2 in complex with compound 11 [Saccharomyces cerevisiae S288C],5OA2_A Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_B Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_C Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA6_A Crystal structure of ScGas2 in complex with compound 12 [Saccharomyces cerevisiae S288C]
2W61_A	1.82e-69	31	369	34	389	Saccharomyces cerevisiae Gas2p apostructure (E176Q mutant) [Saccharomyces cerevisiae]
5FIH_A	1.82e-69	31	369	34	389	SACCHAROMYCES CEREVISIAE GAS2P (E176Q MUTANT) IN COMPLEX WITH LAMINARITETRAOSE AND LAMINARIPENTAOSE [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0XT72|GEL1_ASPFC	2.15e-152	1	384	1	383	1,3-beta-glucanosyltransferase gel1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=gel1 PE=1 SV=1
sp|P0C7S9|GEL1_ASPFU	2.15e-152	1	384	1	383	1,3-beta-glucanosyltransferase gel1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gel1 PE=3 SV=1
sp|Q5AJY5|PGA4_CANAL	3.46e-122	29	373	18	364	1,3-beta-glucanosyltransferase PGA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PGA4 PE=1 SV=1
sp|Q08193|GAS5_YEAST	2.78e-121	25	382	22	385	1,3-beta-glucanosyltransferase GAS5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAS5 PE=1 SV=1
sp|Q9Y7Y7|GAS4_SCHPO	1.22e-115	33	384	28	386	1,3-beta-glucanosyltransferase gas4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gas4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000303	0.999670	CS pos: 27-28. Pr: 0.6752

TMHMM  Annotations     

There is no transmembrane helices in FOMG_06725-t38_1-p1.