CAZyme Information: FOMG_04919-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOMG_04919-t38_1-p1
• CAZy Family: CE1
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
490		55714.24	5.3900

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum26406	20033	1089452	372	19661

• Gene Location: location=JH659331.1:1160376-1161903(-)

Full Sequence      

MSLPKDFQWGFATASYQIEGAIDKDGRGPANWDTFCAKPGKIADGSSGVTACDSYNRTAE
DIALLKSVGAKAYRFSLCWSRIIPLGGRNDPINQAGIDHYRKFVDDLLEAGITPFITLFH
WDVPDELDRRYGGLLNREEFPLDYERYARVVFESIPRCKNWITHNEPWCSAILGYSTGSN
APGRCSDRKKSDVGDSSTEPWIVGHNLLVAHGRAVKLYREEFKPKNGGEIGITLNGDATY
PWNPKDPRDVEAAERKIEFAISWFADPIYFGDYPASMRAQLGDRLPTFTPEEKALVLGSN
DFYGMNHYTANYVKHREGEAAPEDFVGNLELHFWNHRGDCIGEETQSTWLRPCALGFRDL
LVWISKRYGFPRIYVTENGTSIKGENDMPREKILQDDFRVKYYDDYVRAMADASRLDGVD
VHGYFAWSLLDNFEWAEGYETRFGVTYVDYENDQKRYPKKSAQHLKPLFDSLIKQEEHAV
NGNGVKAGQT

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	469	1.7e-154	0.9790209790209791

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395176	Glyco_hydro_1	2.21e-167	2	462	4	441	Glycosyl hydrolase family 1.
225343	BglB	4.86e-133	1	471	2	452	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215435	PLN02814	9.73e-107	2	462	27	473	beta-glucosidase
215455	PLN02849	2.32e-105	4	462	31	473	beta-glucosidase
184102	PRK13511	1.89e-98	2	473	4	467	6-phospho-beta-galactosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGF69228.1|GH1|3.2.1.21	0.0	1	490	1	490
QKD51034.1|GH1	0.0	1	490	1	490
CCT66182.1|GH1	0.0	1	490	1	490
QGI93265.1|GH1	0.0	1	490	1	490
QGI79540.1|GH1	0.0	1	490	1	490

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MDO_A	1.17e-294	1	476	24	499	Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea],4MDP_A Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea]
6EFU_A	1.89e-285	3	476	3	466	Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],6EFU_B Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
5JBK_A	5.15e-283	1	476	1	466	Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum],5JBK_B Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum]
5BWF_A	4.25e-282	3	476	22	485	Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],5BWF_B Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
3AHY_A	5.22e-280	3	473	9	470	Chain A, Beta-glucosidase [Trichoderma reesei],3AHY_B Chain B, Beta-glucosidase [Trichoderma reesei],3AHY_C Chain C, Beta-glucosidase [Trichoderma reesei],3AHY_D Chain D, Beta-glucosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q25BW4|BGL1B_PHACH	2.68e-193	3	473	11	475	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
sp|Q25BW5|BGL1A_PHACH	1.72e-177	3	475	6	462	Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
sp|Q8L7J2|BGL06_ORYSJ	1.73e-140	2	469	49	519	Beta-glucosidase 6 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU6 PE=1 SV=1
sp|Q339X2|BGL34_ORYSJ	3.44e-140	2	471	37	508	Beta-glucosidase 34 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU34 PE=2 SV=1
sp|Q7XKV4|BGL12_ORYSJ	5.54e-139	2	469	38	508	Beta-glucosidase 12 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU12 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000007

TMHMM  Annotations     

There is no transmembrane helices in FOMG_04919-t38_1-p1.