CAZyme Information: FOMG_04484-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOMG_04484-t38_1-p1
• CAZy Family: CBM50|CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375	JH659331.1|CGC6	39824.98	9.5042

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum26406	20033	1089452	372	19661

• Gene Location: location=JH659331.1:9171-10444(+)

Full Sequence      

MKFTLCLSALTALLTSVTAQKVSGSAQGFAQGVTGGGSAAAVTPKNIQELVTYLTDKTPR
VIVLDRTYDFIGSEGTVKEKGCAPWKTGAGCQLAINAAGNWCGNNPKVDVTYSKAGTSGI
NVASDKTIIGVGNKGIIKGKGLRFVNVKNIIVQNIHVTNLNPQYVWGGDAFTFSGTSKIW
VDHCTTSLLGRQHYVFGRDKSTGITLSNNHIDGRTQWSAGCDGYHYWTIEMVGQGDQITL
QNNLIEHTAGRGPALSATTFLHAVNNVWRDINGHAIEGDTAGKGLFEGNVFQNVKQVVVP
DFKGQLNSCPDNAAASATQQYLGRVCQGNIFISSGAFNRKDTGFLSEFKGLPIARSTQAT
TARSKVPGNAGFGKI

Enzyme Prediction     

EC	4.2.2.10:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	110	293	4.7e-79	0.9893048128342246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	2.20e-50	109	295	1	190	Amb_all domain.
226384	PelB	5.89e-16	3	293	5	275	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	1.09e-08	93	291	4	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT66530.1|PL1_4	2.80e-275	1	375	1	375
CEI61602.1|PL1_4	5.65e-275	1	375	1	375
CEF77859.1|PL1_4	1.14e-274	1	375	1	375
QPC59181.1|PL1_4	6.59e-274	1	375	1	375
CZS81153.1|PL1_4	1.33e-273	1	375	1	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IDK_A	7.66e-122	22	375	3	359	Pectin Lyase A [Aspergillus niger]
1IDJ_A	7.57e-117	22	375	3	359	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1QCX_A	6.48e-113	22	374	3	359	Pectin Lyase B [Aspergillus niger]
3VMV_A	8.61e-10	103	375	59	325	Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 [Bacillus sp. N16-5],3VMW_A Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 in complex with trigalacturonate [Bacillus sp. N16-5]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QW65|PELC_ASPNC	1.93e-137	5	375	9	373	Probable pectin lyase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelC PE=3 SV=1
sp|B8N6W5|PELA_ASPFN	4.15e-137	19	375	20	375	Probable pectin lyase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelA PE=3 SV=1
sp|Q2UCT7|PELC_ASPOR	4.15e-137	19	375	20	375	Probable pectin lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelC PE=3 SV=1
sp|Q5MBK3|PELC_ASPNG	4.60e-137	5	375	9	373	Probable pectin lyase C OS=Aspergillus niger OX=5061 GN=pelC PE=3 SV=1
sp|A1CFS2|PELA_ASPCL	8.06e-133	9	375	8	378	Probable pectin lyase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=pelA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000233	0.999739	CS pos: 19-20. Pr: 0.9806

TMHMM  Annotations     

There is no transmembrane helices in FOMG_04484-t38_1-p1.