CAZyme Information: FOMG_03543-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOMG_03543-t38_1-p1
• CAZy Family: AA9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371	JH659330.1|CGC3	39044.63	4.8253

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum26406	20033	1089452	372	19661

• Gene Location: location=JH659330.1:2855347-2856563(-)

Full Sequence      

MSMKRFFTSAVAMAAVVAAVPVARPLEKREPVTTITLTSASTYTATIAPATPVTPTGTAT
YPGTTAPVPDSPKPPKNGKPDGSCSSTDTCGSGSGGSSSGSKLPGVAYAPYRGDHQCKSK
DEIQHDITQLAADFSVLRIYGTDCDQVANVYSCAKGSGLKLFLGIWNIDDVQTEAKTIIS
AIDDWDVVDTISVGNELVNNGAASPAKVIAAVKQAREILRAAGYQGPVVTVDTFIAANAN
PELCNESDYCAINAHAFFDANTSADEAGQWLSNTVEDLRSKISGDKRIVICETGWPTKGN
SNGKAVPGMSQQKAALDSIKQAFSSHMGDLILFSAFNDPWKKAEAATFMAEQWWGIEGQE
SVSNKDPSSSN

Enzyme Prediction     

No EC number prediction in FOMG_03543-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	112	356	6.2e-24	0.932475884244373

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	3.23e-72	36	356	2	300	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	1.54e-07	130	356	33	296	Glycosyl hydrolases family 17.
166942	tatB	1.25e-04	25	77	84	140	Sec-independent protein translocase subunit TatB.
236792	PRK10905	0.009	25	86	182	239	cell division protein DamX; Validated

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD49574.1|GH17	2.27e-247	1	371	1	371
QGI63520.1|GH17	8.92e-221	1	371	1	348
QGI80797.1|GH17	8.92e-221	1	371	1	348
QGI94402.1|GH17	8.92e-221	1	371	1	348
CCT67472.1|GH17	8.92e-221	1	371	1	348

PDB Hits     

FOMG_03543-t38_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P53334|SCW4_YEAST	3.13e-73	97	356	127	382	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1
sp|Q04951|SCW10_YEAST	1.18e-70	105	356	138	385	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1
sp|Q59XX2|MP65_CANAL	1.90e-69	94	356	118	375	Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MP65 PE=1 SV=3
sp|Q0CEX9|BTGE_ASPTN	1.97e-40	100	355	299	553	Probable beta-glucosidase btgE OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=btgE PE=3 SV=1
sp|B0Y9Q9|BTGE_ASPFC	2.14e-40	105	355	310	559	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000271	0.999671	CS pos: 29-30. Pr: 0.9702

TMHMM  Annotations     

There is no transmembrane helices in FOMG_03543-t38_1-p1.