CAZyme Information: FOMG_02371-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOMG_02371-t38_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
845		92106.42	7.9262

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum26406	20033	1089452	372	19661

• Gene Location: location=JH659329.1:6314165-6316763(+)

Full Sequence      

MPPGGIKSDGTGHIALDDVEHAPSGKVDDQGRVDVHFHDSPQVLKVWCERFQSKFGRDAA
EAPLSQAETTCGNAAPGIAKLASPRLNIAIHVVGSRGDVQPFIPIAQMLSRPPFNHRVRI
CTHPVFKDFIEGHGIEFFSIGGDPEALMAYMVKNPSLLPSLKSVKDGDISKRRKEMWEIM
HGAWRSCIEAGDGMAGPIKAANIQSPKDLFIADAIIANPPSMAHIHCAEKLGIPLHIIFT
MPWSPTEIFSHPLAAMSYGDADTAVANYLSFMMLELLTWQGLGDLINKLRTQILRLNPIS
PMWGYQLLSRLRVPHSYLWSKSLIPKPSDWASHINVTGFSFLPLASSYTPPPDLVTFLEK
GTPPIYIGFGSIVVEDPQALRNLVFDAVKLANVRAVVSQGWGTLGGEDVGVPENLYLIGN
CPHDWLFQRVSAVVHHGGAGTTAAGIAAGRPTVVVPFFGDQPFWGQMIARAGAGPTPIPF
KKMTAESLAASILFALNPEVKEAAQRLAQTIMQEDGASNAAMDFLNRLDVDELRCDLCPD
RLAIWKHKSTGTRLSGFAMTCLVDKKLVQPNDSKLLQHRHWYVNEGAEHPIIGAVAAASG
LFTALGTAASDYHGRLKGRHRPVASSSETLHQPSSSATIVDEGAEFPTSSRDNIKDHDGI
LKGFLYSNPLTPMEMETIAYKIATKSLRTAEPDVAKTQRAPTVYDKQKAAWRAQEQGING
HAYYIARATGRFAVDVTKASLKAPVAFFYNVANGFHNYPSYSFGATEVRRRGEITGLGSG
LRVAGEEFVLGFWDAFSGLVMKPYERTKDEGARGFSKGVLRGARGFAYNLGACEFPIVFW
PPQGR

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	206	521	9.8e-59	0.743455497382199

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.43e-65	86	521	1	398	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	1.08e-31	88	521	4	392	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	1.04e-17	88	250	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
273616	MGT	1.96e-08	359	521	222	383	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD46415.1|GT1	0.0	1	845	1	822
UPK91708.1|GT1	0.0	6	844	6	836
QKD57931.1|GT1	0.0	6	835	6	822
QKD55584.1|GT1	0.0	6	844	6	842
QGI65525.1|GT1	0.0	6	844	6	842

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	6.12e-75	93	529	27	440	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	1.03e-74	93	529	47	460	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	5.66e-31	86	521	1	391	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	1.56e-30	86	521	1	374	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	1.57e-24	86	521	1	392	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	5.77e-128	84	527	154	572	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	1.16e-122	84	528	191	610	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|A0A2Z4HPY4|EFUA_HORCR	2.28e-78	76	581	687	1181	Enfumafungin synthase efuA OS=Hormonema carpetanum OX=284138 GN=efuA PE=3 SV=1
sp|Q9Y751|ATG26_KOMPG	1.71e-76	85	520	760	1170	Sterol 3-beta-glucosyltransferase OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=ATG26 PE=3 SV=1
sp|Q54IL5|UGT52_DICDI	3.72e-74	86	527	1164	1607	UDP-sugar-dependent glycosyltransferase 52 OS=Dictyostelium discoideum OX=44689 GN=ugt52 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000066	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOMG_02371-t38_1-p1.