CAZyme Information: FOMG_02299-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOMG_02299-t38_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377	JH659329.1|CGC5	39893.22	9.5841

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum26406	20033	1089452	372	19661

• Gene Location: location=JH659329.1:6139183-6140367(-)

Full Sequence      

MRLLDVFVAVVAFLPTSFAALPTQAEGFASSTTGGKGGQVVRPKNNQELANYLKDNTARI
IYLERTFDFKGSEGSATETGCAPWGTGAHCQLSINKNQWCTNYNPGAQKVTVKYDKAGLN
PLMVGSNKSIIGVGSKGVIKGKGLRLANGVKNVIIQNIHITDLNPSLVWGGDAITLDGTD
NIWIDHCTTSLIGRQHIVLGTGASGRVSITNNKIDGVSPWSASCNTYHYWAILFLGKSDL
ITFKGNYMYHVSGRAPKVSGNTLLHVVNNYFHDVFDHAFEIEENGQVLAEGNAFQNVKNP
LKTGTKGRLFTVPTAGSAGSCKASLGRACQMNAFGSSGAFPGDDTGFLGSFKGKTIASAA
SAQSAKNAMTKAGFGLA

Enzyme Prediction     

EC	4.2.2.10:25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	111	296	2.7e-88	0.9946524064171123

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	6.50e-57	109	298	1	190	Amb_all domain.
226384	PelB	7.32e-23	3	301	6	280	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	6.75e-18	115	294	23	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD46500.1|PL1_4	7.19e-279	1	377	1	377
QGI59750.1|PL1_4	3.27e-275	1	377	1	377
CCT63296.1|PL1_4	3.27e-275	1	377	1	377
QGI76951.1|PL1_4	3.27e-275	1	377	1	377
QGI90665.1|PL1_4	3.27e-275	1	377	1	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	1.32e-140	25	359	7	341	Pectin Lyase B [Aspergillus niger]
1IDK_A	1.53e-139	25	359	7	340	Pectin Lyase A [Aspergillus niger]
1IDJ_A	1.24e-138	25	359	7	340	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
3VMV_A	7.02e-14	26	297	5	249	Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 [Bacillus sp. N16-5],3VMW_A Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 in complex with trigalacturonate [Bacillus sp. N16-5]
1VBL_A	6.87e-11	26	294	12	330	Structure of the thermostable pectate lyase PL 47 [Bacillus sp. TS-47]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WV10|PELA_ASPFU	5.17e-147	1	370	1	372	Probable pectin lyase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pelA PE=3 SV=1
sp|Q5BA61|PELB_EMENI	1.64e-145	16	359	17	360	Pectin lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelB PE=2 SV=1
sp|B0XT36|PELA_ASPFC	5.23e-144	25	359	25	359	Probable pectin lyase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pelA PE=3 SV=1
sp|Q4WIS6|PELB_ASPFU	5.23e-144	25	359	25	359	Probable pectin lyase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pelB PE=3 SV=1
sp|Q0CYL8|PELA_ASPTN	1.72e-142	25	359	26	359	Probable pectin lyase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000232	0.999744	CS pos: 19-20. Pr: 0.9470

TMHMM  Annotations     

There is no transmembrane helices in FOMG_02299-t38_1-p1.