CAZyme Information: FOMG_02048-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOMG_02048-t38_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
638	JH659329.1|CGC16	70037.56	4.6440

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum26406	20033	1089452	372	19661

• Gene Location: location=JH659329.1:5571230-5573404(-)

Full Sequence      

MILNRLKFALAAVLTGSSTTLATKPDIYDYVIIGSGPGGGSLAANLAREGHSVFLIEAGG
DNHTSILEQLPALARTAAETPGHSWQFFVNHYDDFDSARRDPKYTYIQTNGSYYVGLDPP
EGARPAGLYYPRGSTLGGSAQVNAMNFAWCPDNEWDYIANLTGDTSWGHEHMRRHLMNIE
NCTYIPEGTPGHGFDGYLVNDQSNATVNIGSPNVANFFSQMFRETEGIDVENPAEMTELL
LRDLNGLDPRRYENGLMYSTPVAIDPSTAARSGAGIYINQVIDAGHPLTVSFHSLATRVL
TKQGRNKKPRAYGVEYMVGEGLYSADGRYDPEQTGEIREVHAKHEVIVSGGAFNTPQILM
LSGIGPREELEAWDIPVVVDLPAVGSNLHDNYEVPVQIRGEENWLIPRESPCTGTFDDED
PCFVLWRDNASGPYAARDSSYGAVWRSSQSWDNDSDLMFLSSPGLSGLVGFYPGYSTGER
AGNDPAEWMHAVVKMQTSNSAGTVRLNSSDPRIRPNINFNYFTESAERDLDSIVEGIELL
RRAFDATGVAYTQLSPDPENLRQSIQDLAFSHHASSTCAIGADHDKNSCLDSRFRVRGVD
NLRVVDASVFPRSPGGMPNGPTWTISRKAFETLLEDNH

Enzyme Prediction     

No EC number prediction in FOMG_02048-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	28	635	5.5e-92	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.28e-52	28	629	6	527	choline dehydrogenase; Validated
225186	BetA	5.41e-52	42	637	22	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.07e-30	499	629	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	9.24e-22	284	618	229	561	Protein HOTHEAD
366272	GMC_oxred_N	1.56e-13	128	393	19	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD46715.1|AA3	0.0	1	638	1	638
QGI76742.1|AA3	0.0	1	638	1	638
QGI90450.1|AA3	0.0	1	638	1	638
QGI59540.1|AA3	0.0	1	638	1	638
CCT63073.1|AA3	0.0	1	638	1	638

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4H7U_A	2.96e-34	28	629	41	593	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3FIM_B	2.98e-29	28	636	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
5OC1_A	3.96e-29	28	636	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
7AV4_AAA	4.69e-26	13	633	71	636	Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
3NNE_A	6.69e-26	28	633	14	526	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7MF12|BETA_VIBVY	3.95e-41	28	634	5	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1
sp|Q8D3K2|BETA_VIBVU	7.34e-41	28	634	5	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1
sp|Q6LGH5|BETA_PHOPR	2.81e-40	28	634	5	531	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1
sp|Q88AE7|BETA_PSESM	7.08e-40	23	633	2	535	Oxygen-dependent choline dehydrogenase OS=Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000) OX=223283 GN=betA PE=3 SV=1
sp|Q48CM7|BETA_PSE14	3.30e-39	23	633	2	535	Oxygen-dependent choline dehydrogenase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) OX=264730 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.005435	0.994540	CS pos: 22-23. Pr: 0.9492

TMHMM  Annotations     

There is no transmembrane helices in FOMG_02048-t38_1-p1.