CAZyme Information: FOMG_01045-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOMG_01045-t38_1-p1
• CAZy Family: AA2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
831	JH659329.1|CGC15	90927.90	8.5976

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum26406	20033	1089452	372	19661

• Gene Location: location=JH659329.1:2874343-2876892(+)

Full Sequence      

MLAFKAIFVAILQISSASLGTSRSTSKPCRSVAPSFWPDGIAVDTSYKAKTSKLSRFTLN
SRSRVATVDYGTERAGLPFFEVVELEKPVQVELRFSEAFIYLKEPWSDGPYLFNTGQANS
FRVETFNITQPGCYKSRFVQGGQRWQALRLLTDSFVTIRNVGLESTINTVEVRDLPGAFS
CSDNILNDIWKLGARATIDSCLGKSTQPAVWQIDPNNGAYVANQRPAMTIEGHSFTNYTL
EFDAFIDRGGFWWAVAQPLALDGLHIQLTGEMPSRSSFANTNNTVTPPNTLLLASGFGFV
NQTTLPSYILASTKIPFSVKEKTWYRIKTVLGGEGKLEISVDGREVLKVNLTNYAPGGKP
VSTTGPFGFGAWQDQAAYFRNAIAYDTANKSVIYRNPLTGPETLVEYGTQENLGTVCLDG
PKRDRLVWLGDFYHTSRIIGASTGGFNYTRGTFDFLLQTQIRSGQIAIAPYLGYDPTKTG
TLSLERVYGLDDYQLLGFLAFAHYIRQTNDLQYARKTWSQWEKQLSWLASNINPTSGLAD
FGFTFLGAAQGGSLGSCATVETLNAAADIAEAIGKKTSPKYRKLATDLARSVNQKLWNKA
LGTYGYALGDLNTSSVAGTAFCLSSDVASKERAVSAVAALDELQLGLGYKDRSTLDDHGI
ETKISPNTNGLLLQAILAGEDWDRAAKLIYNVWGAMLKDHETRSGASWEYLTPAGQPGLG
AFTSLGHPWGGAATYILTEWVAGLRSADGIQGFGYKNWVVNPELGAHMGLSHASAKVPLY
PSGELEVKWSIKSKKMAVQIKAPPETKGVFWIGKTKKTLENDSSYQFTIQL

Enzyme Prediction     

No EC number prediction in FOMG_01045-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	404	810	1.6e-53	0.748015873015873

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	1.39e-07	374	640	1	254	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	7.42e-04	754	825	8	76	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD47609.1|GH78	0.0	1	831	1	831
QGI58704.1|GH78	0.0	4	831	4	831
QGI89614.1|GH78	0.0	4	831	4	831
CCT62249.1|GH78	0.0	4	831	4	831
QGI75923.1|GH78	0.0	4	831	4	831

PDB Hits     

FOMG_01045-t38_1-p1 has no PDB hit.

Swiss-Prot Hits     

FOMG_01045-t38_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000452	0.999513	CS pos: 17-18. Pr: 0.9712

TMHMM  Annotations     

There is no transmembrane helices in FOMG_01045-t38_1-p1.