CAZyme Information: FOIG_16946-t36_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOIG_16946-t36_1-p1
• CAZy Family: GT66
• CAZyme Description: chitinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
250		27495.89	6.4955

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FodoratissimumNRRL54006	16975	1089451	341	16634

• Gene Location: location=KK036397.1:446-1299(+)

Full Sequence      

MPNSNAYGCVKEIFHLKKQNPHFKVLLSIGGWTLSSTFPAVASTSVTRKKFASSAVELMK
DWGFDGIDVDWEYPAGEDEANNFLLLLQAVREELDFYARKHARNHHFELSIAAPAGPDHY
RILRLSDIGNVVDHINLMAYDYAGSFSATTGHTANLYTNDAVPGSTPFSSDTAIKAYLAA
GVPSRKLVLGIPLYGRSFENTDGLGQKFTTSEEGSWEKGTWGYKELPRSPSAKMFCDQKA
EGQYVLGSLG

Enzyme Prediction     

EC	3.2.1.14:58

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	17	244	1.4e-56	0.6351351351351351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119365	GH18_chitinase	3.01e-86	2	200	64	268	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
214753	Glyco_18	5.27e-85	5	245	49	294	Glyco_18 domain.
395573	Glyco_hydro_18	7.96e-73	5	245	45	269	Glycosyl hydrolases family 18.
225862	ChiA	1.35e-62	4	229	108	353	Chitinase, GH18 family [Carbohydrate transport and metabolism].
119351	GH18_chitolectin_chitotriosidase	5.81e-59	16	226	64	282	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEI62152.1|GH18	6.79e-107	2	244	95	336
AAX19153.1|GH18	2.05e-105	4	244	48	287
CZS81714.1|GH18	4.44e-105	2	244	95	336
CEF78421.1|GH18	4.44e-105	2	244	95	336
QPC70901.1|GH18	4.44e-105	2	244	95	336

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3G6L_A	1.32e-102	4	229	86	311	The crystal structure of a chitinase CrChi1 from the nematophagous fungus Clonostachys rosea [Clonostachys rosea],3G6M_A crystal structure of a chitinase CrChi1 from the nematophagous fungus Clonostachys rosea in complex with a potent inhibitor caffeine [Clonostachys rosea]
6EPB_A	8.22e-100	4	248	103	346	Structure of Chitinase 42 from Trichoderma harzianum [Trichoderma harzianum]
6YLJ_A	1.07e-97	4	248	103	346	Chain A, Endochitinase 42 [Trichoderma harzianum],6YN4_A Chain A, Endochitinase 42 [Trichoderma harzianum],7AKQ_A Chain A, Endochitinase 42 [Trichoderma harzianum]
1WNO_A	1.19e-87	4	229	71	296	Crystal structure of a native chitinase from Aspergillus fumigatus YJ-407 [Aspergillus fumigatus],1WNO_B Crystal structure of a native chitinase from Aspergillus fumigatus YJ-407 [Aspergillus fumigatus]
6IGY_A	2.62e-87	4	227	81	304	Crystal structure of Aspergillus niger chitinase B [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32470|CHI1_APHAL	7.07e-103	4	244	103	342	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2
sp|P48827|CHI42_TRIHA	3.41e-98	4	248	103	346	Endochitinase 42 OS=Trichoderma harzianum OX=5544 GN=chit42 PE=1 SV=1
sp|E9ERT9|CHI1_METRA	1.61e-96	4	244	104	343	Endochitinase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chit1 PE=3 SV=1
sp|A6N6J0|CHI46_TRIHA	5.45e-96	4	244	104	349	Endochitinase 46 OS=Trichoderma harzianum OX=5544 GN=chit46 PE=1 SV=1
sp|O14456|CHI1_METAN	2.70e-89	4	224	104	323	Endochitinase 1 OS=Metarhizium anisopliae OX=5530 GN=chit1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOIG_16946-t36_1-p1.