CAZyme Information: FOIG_16030-t36_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOIG_16030-t36_1-p1
• CAZy Family: GT34
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
785	KK036137.1|CGC1	85524.05	6.4111

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FodoratissimumNRRL54006	16975	1089451	341	16634

• Gene Location: location=KK036137.1:45285-48417(-)

Full Sequence      

MVLKKVTPDDVHSDFDVEHVIQNASVSDKISLLSGRDFWHTNPLPAFNVPSVRVSDGPNG
VRGTKFVDGVPAACLPCGTGLAATWDQDLLYKAGVLIGNECIAKGAHCWLGPTVCIQRSP
LGGRGFESMAEDPYATGKLAAAYIKGVQSTGVVSIIKHWLANDQEHERVGVNVVASERAL
REVHMLPFQIALSDAAPGGVMACYNKVNGKHVSENRDFLDSLLREEWQWKGLIMSDWFGT
YSTTEAINAGLDLEMPGPTRQRGQLLDLAVSTRKVSRSTIDARARNVLEFVQRCTKVPVA
AEEGGRDYPEDRQLNRKLAGDSVVLLKNENNQLPLKRPFKSIALIGPNMKTTSFCGGGSA
HLRPYYTVSPYEGIVAQLPPDVEVRYEVGASASGWNPLMQGEMMTTPEGSPGMRMRFYSQ
GPSVPGREIIDESHLPDSSWLLMGYSHPKLDKLFYATVEGDLVIQETGVFEFGLAVYGSA
RLYVDGQLLIDNNLVQRGGTFFFGKGTVEEKAQKRLVQGQKYRITVEYESAPSSKLVKPG
VVNFGGGAGRVGLASAIDPEIGIQNAVSAALQSDVTILCVGMTRDQESEGFDRPHMDLPR
SLPRLASAVLAAVPDAIVVTQSGTPFNMLWAESAKTHVHAWLAGNETGNGIADVLFGATC
PSGKLPLSFPRRLQDTPTFLNFGSERGRVIYGEDIYVGYRYYEKVDRDVLYPFGHGLSYT
TFTYDKLNLASSHVSFEITNSGSVPGAEVSQLYIAADEATSSIQRPKKELKGFKKTYLQP
DSVPG

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	47	256	2.3e-60	0.9675925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.18e-66	76	780	121	715	beta-glucosidase BglX.
224389	BglX	4.30e-58	45	348	56	363	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	9.87e-44	323	699	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	9.41e-35	75	289	88	315	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	3.67e-23	46	777	95	729	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD62358.1|GH3	0.0	1	780	1	801
CEI61991.1|GH3	0.0	1	780	1	780
CCT75247.1|GH3	0.0	1	780	1	780
UPK90003.1|GH3	0.0	1	780	1	781
ABF50857.1|GH3	0.0	14	780	10	778

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	3.90e-223	13	780	2	784	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.80e-218	13	780	2	784	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	6.11e-123	16	780	4	617	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.55e-104	21	779	9	611	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	3.39e-83	41	778	43	661	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0YBJ3|BGLK_ASPFC	0.0	14	704	10	666	Probable beta-glucosidase K OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglK PE=3 SV=1
sp|Q4WA69|BGLK_ASPFU	0.0	14	704	10	690	Probable beta-glucosidase K OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglK PE=3 SV=1
sp|Q5BA18|BGLK_EMENI	0.0	14	780	10	778	Probable beta-glucosidase K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglK PE=2 SV=1
sp|Q2U9M7|BGLH_ASPOR	4.19e-286	16	780	4	767	Probable beta-glucosidase H OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglH PE=3 SV=2
sp|B8NPL7|BGLH_ASPFN	8.42e-286	16	780	4	767	Probable beta-glucosidase H OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000003	0.000039

TMHMM  Annotations     

There is no transmembrane helices in FOIG_16030-t36_1-p1.