CAZyme Information: FOIG_15781-t36_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOIG_15781-t36_1-p1
• CAZy Family: GT32
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
441		49213.83	7.1747

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FodoratissimumNRRL54006	16975	1089451	341	16634

• Gene Location: location=KK036135.1:5251-6908(+)

Full Sequence      

MSFSHRFMAFWLLFTSVAKGLDLNTFTGQAQVLGRQREMILNQYKSDGTVQPMRMMVKPD
TDDSDGKCTKTKGCKLGCCGPLNKEGVGICGTGPKFCGKDCTSECSYKSECDQGGWSLKY
SNFTTCPLNVCCSDYGFCGTLASYCKGRTVASPKCDTAKHSSDKRTIGYYEGWNYQRPCG
NMEPEDIPFGYYTHIDFAFALVNPDTYRLDPMDAGTASHYGRVSALKEQQNDLEVWIAIG
GWAMNDPGKYRTVFYDWAKSEKSPAAEDRGGVEEDFENYVNLLARLRKRLNASGRKYGLT
LNLPASYWCLKGFDIVNMEKYLDWFNIMKYDIHGVWDENIESLGPYAHAHINLTEIQQVL
ELLWRNNINPERVVMGLGFYGRSFTVKSSNCLDSGCEFSSGAKGGECTGTKGVLSASEIN
KIVKNGGKMKLDKETAVQIVT

Enzyme Prediction     

EC	3.2.1.14:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	164	425	1.7e-37	0.7601351351351351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119357	GH18_zymocin_alpha	8.66e-50	165	441	1	307	Zymocin, alpha subunit. Zymocin is a heterotrimeric enzyme that inhibits yeast cell cycle progression. The zymocin alpha subunit has a chitinase activity that is essential for holoenzyme action from the cell exterior while the gamma subunit contains the intracellular toxin responsible for G1 phase cell cycle arrest. The zymocin alpha and beta subunits are thought to act from the cell's exterior by docking to the cell wall-associated chitin, thus mediating gamma-toxin translocation. The alpha subunit has an eight-stranded TIM barrel fold similar to that of family 18 glycosyl hydrolases such as hevamine, chitolectin, and chitobiase.
214753	Glyco_18	1.16e-42	165	437	1	291	Glyco_18 domain.
119365	GH18_chitinase	3.12e-39	167	385	2	267	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
225862	ChiA	1.39e-36	148	412	21	346	Chitinase, GH18 family [Carbohydrate transport and metabolism].
395573	Glyco_hydro_18	2.19e-35	165	438	1	267	Glycosyl hydrolases family 18.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEN14642.1|CBM18|GH18	6.02e-292	19	441	19	467
UPK94778.1|CBM18|GH18	6.87e-229	16	441	18	473
AEO68677.1|CBM18|GH18	1.22e-188	54	441	36	446
ABI48362.2|CBM18|GH18|3.2.1.14	2.07e-185	62	441	41	446
ABK27625.2|CBM18|GH18|3.2.1.14	2.07e-185	62	441	41	446

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5WUP_A	2.82e-26	156	437	85	397	Crystal structure of a insect group III chitinase (CAD1) from Ostrinia furnacalis [Ostrinia furnacalis],5WV9_A Crystal structure of a insect group III chitinase complex with (GlcNAc)6 (CAD1-(GlcNAc)6) from Ostrinia furnacalis [Ostrinia furnacalis]
5WV8_A	7.03e-26	156	437	85	397	Crystal structure of a mutant insect group III chitinase (CAD1-E217L) from Ostrinia furnacalis [Ostrinia furnacalis],5WVB_A Crystal structure of a mutant insect group III chitinase complex with (GlcNAc)6 (CAD1-E217L-(GlcNAc)6) from Ostrinia furnacalis [Ostrinia furnacalis]
5WUS_A	3.64e-25	163	424	1	287	Crystal structure of a insect group III chitinase (CAD2) from Ostrinia furnacalis [Ostrinia furnacalis],5WVH_A Crystal structure of an insect group III chitinase complex with (GlcNAc)6 (CAD2-(GlcNAc)6) from Ostrinia furnacalis [Ostrinia furnacalis]
5WVF_A	1.66e-24	163	424	1	287	Crystal structure of a mutant insect group III chitinase (CAD2-E647L) from Ostrinia furnacalis [Ostrinia furnacalis],5WVG_A Crystal structure of a mutant insect group III chitinase complex with (GlcNAc)5 (CAD1-E647L-(GlcNAc)5) from Ostrinia furnacalis [Ostrinia furnacalis]
6JM7_A	3.25e-21	161	439	1	309	Crystal structure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis],6JMB_A Chain A, ofchtiv-allosamidin [Ostrinia furnacalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P09805|KTXA_KLULA	6.08e-31	109	419	317	652	Killer toxin subunits alpha/beta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 PE=1 SV=1
sp|G5EAZ3|CHIB1_EMENI	4.78e-19	162	384	2	261	Endochitinase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chiB PE=1 SV=1
sp|Q92222|CHIB_EMEND	4.78e-19	162	384	2	261	Endochitinase B OS=Emericella nidulans OX=162425 GN=chiB PE=1 SV=3
sp|Q9W5U2|CHI10_DROME	1.13e-17	162	427	963	1257	Probable chitinase 10 OS=Drosophila melanogaster OX=7227 GN=Cht10 PE=2 SV=2
sp|P36362|CHIT_MANSE	3.35e-17	149	390	7	280	Endochitinase OS=Manduca sexta OX=7130 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000260	0.999713	CS pos: 20-21. Pr: 0.9747

TMHMM  Annotations     

There is no transmembrane helices in FOIG_15781-t36_1-p1.